(data stored in ACNUC7421 zone)

EMBL: CP002047.PE10

CP002047.PE10        Location/Qualifiers
FT   CDS_pept        complement(8657..8944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00010"
FT                   /product="hypothetical protein"
FT                   /note="COG0804 Urea amidohydrolase (urease) alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03131"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV4"
FT                   /protein_id="ADI03131.1"
FT                   /translation="MSVWSLETSGTSTEGLFHVRGPVPDDVAGADRRTMSPREVAADLA
FT                   QQAMVAGDQARMDALAEVADQLLANSRAEVGEDCDGQLTRARGGGVTAAI"
     gtgtcggtgt ggagcctgga gacctcgggg accagcaccg agggcctttt ccacgtgcgg        60
     ggacccgtgc cggacgatgt ggccggggcc gaccggcgca cgatgagccc gcgcgaagtc       120
     gccgctgatc tcgcccagca ggccatggtc gcaggagacc aggcgcgaat ggacgctttg       180
     gctgaggtcg ccgaccagtt gctcgccaac tcgcgagccg aagtcggcga ggactgcgac       240
     gggcaactca ccagggcccg gggggggggc gtcactgctg cgatctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page