(data stored in ACNUC7421 zone)

EMBL: CP002047.PE101

CP002047.PE101       Location/Qualifiers
FT   CDS_pept        complement(91902..92648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00101"
FT                   /product="putative 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03222"
FT                   /db_xref="GOA:D7BUN1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN1"
FT                   /protein_id="ADI03222.1"
FT                   /translation="MGLETARLLARDGAAVVLLGRRQQTLDAVAATIRAEGGTALALAT
FT                   DITRADDVTRVLDRVRAELGPVDVLVNNAGSASSVLNPQWLPHDEWRQVLDVNLTAVFQ
FT                   LTQAVLPDMLGRGTGTIVTVSSLAAVNPNLLGGAAYGAAKAGVRNFMTFLHNTFRNQGL
FT                   RAITVLPGEADTPILDNRARPPAPEERADMVRPEDVAEAIRLAVALPQRVVLQEIVVAP
FT                   TRQRDTSADLEISRWAGAPADAAPQA"
     atgggactgg agaccgcacg actgctcgcc cgggacggcg ccgccgtcgt actgctcggc        60
     cgcagacagc agacgctcga cgccgtcgcc gccacgatcc gcgccgaggg agggaccgcc       120
     ctcgccctcg ccacggacat cacccgcgcg gacgacgtga cacgcgtcct cgaccgggta       180
     cgagccgaac tcggcccggt cgacgtcctg gtcaacaacg cgggcagcgc ctcatcggtg       240
     ctcaacccgc agtggctccc acatgacgag tggcgccaag tcctcgacgt caacctcacc       300
     gcggtcttcc agctcaccca ggccgtgctt cccgacatgc tcggccgcgg caccgggacc       360
     atcgtcaccg tctcctcgct cgccgcggtc aaccccaacc tgctcggcgg cgctgcctac       420
     ggcgcggcca aggccggcgt ccgcaacttc atgaccttcc tgcacaacac cttccgcaac       480
     cagggtctgc gggcgatcac cgtgctgccg ggcgaggcgg acacccccat cctcgacaac       540
     cgcgccagac ccccggcgcc ggaggagcgc gccgacatgg tgcggcccga ggacgtggcc       600
     gaggccatcc gcctggccgt cgcccttccc cagcgcgtcg tcctccagga gatcgtcgtc       660
     gcccccaccc ggcagcgcga cacctccgcc gacctcgaga tcagccgctg ggcgggcgcg       720
     cctgccgacg ccgcaccgca ggcctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page