(data stored in ACNUC7421 zone)

EMBL: CP002047.PE102

CP002047.PE102       Location/Qualifiers
FT   CDS_pept        complement(92753..93757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00102"
FT                   /product="allophanate hydrolase subunit 2"
FT                   /note="COG1984 Allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03223"
FT                   /db_xref="GOA:D7BUN2"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN2"
FT                   /protein_id="ADI03223.1"
FT                   /translation="MKTVALDITSTGWVTTFQDLGRRDTERRGVPTGGAADQHSAAVAN
FT                   LLVGNPRGAALIENLGGELAFVPDADVLLAVTGAPARVTVAGSPADGWSPLVVPAGHEV
FT                   RVRGDMDQGTRTYLAVNGTPRTKTLLGSAAPDARMGFGQAVTRGSRVLLETEFRGFRRR
FT                   LFEPPLFRLPVPVPRFDAGPWDIDVVAGHGVQAIAGIREVIEEATYVVTPRSNHVGLRL
FT                   DGPVLHPDTDTEIVSHGVPIGALQIPHADELIVLGRYRSLTAGYPIVGVASRASLPLLG
FT                   QAGPGRRLRFRWIDREASLRRFARREAEVRALGYAAAEAFGALGFMEPLRHMN"
     atgaagaccg tggcgctcga catcaccagc accggatggg tcactacgtt tcaggacctc        60
     ggccgccgtg acacggaacg gcgcggtgtg cccaccggcg gcgcggccga ccagcactcg       120
     gcggccgtcg cgaatctcct cgtgggcaac ccccgcggcg cggcactgat cgagaacctc       180
     ggaggtgagc tggccttcgt gcccgacgcc gatgtcctgc tcgccgtgac cggcgcaccc       240
     gcccgggtca ccgtcgccgg ttcgcccgcc gacgggtggt cgccgctggt cgtgccggcg       300
     ggccatgagg tccgggtccg tggggacatg gaccagggga cccgcaccta tttggccgtg       360
     aacggaacgc cgcgcaccaa aacccttctg ggcagcgccg ccccggacgc ccggatggga       420
     ttcggacagg ccgtcacccg gggctcgcgc gtgctgctcg agacggagtt ccgggggttt       480
     cggcgtcggc tgttcgagcc gccgctgttc cggctgcccg tccccgtccc gcgtttcgac       540
     gccggcccct gggacatcga tgtcgtcgcc ggccacggcg tccaggcgat cgccggcatc       600
     cgcgaggtaa tcgaggaggc gacctacgtc gtcacccctc gctccaacca cgtcgggctc       660
     cggctcgacg gaccggtact tcacccggac accgacaccg agatcgtgtc ccacggcgtg       720
     cccatcgggg cgctgcagat cccgcacgcg gacgagctga tcgtcctcgg ccgctaccgg       780
     agcctgaccg cgggctatcc catcgtcggc gtcgcctcac gggcgtccct gcccctgctc       840
     gggcaggccg gaccggggcg ccggctccgg ttccgctgga tcgaccggga ggcgtcgctc       900
     cgtcgcttcg cgcgccgtga agccgaggtc cgcgcgctcg ggtacgcggc tgccgaggca       960
     ttcggcgctc tgggcttcat ggaacccttg cgtcacatga attga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page