(data stored in ACNUC7421 zone)

EMBL: CP002047.PE103

CP002047.PE103       Location/Qualifiers
FT   CDS_pept        complement(93754..94491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00103"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="COG2049 Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03224"
FT                   /db_xref="GOA:D7BUN3"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN3"
FT                   /protein_id="ADI03224.1"
FT                   /translation="MTTAQYGAITVEPFGDSAVMVTIPHADQAIRRAGIVAFRDRFLAH
FT                   RPHGVLDVVSGLESLLIEFDPMQTALEHVEYAARLVARWAPSPTDGPARRRAVRTFAIP
FT                   VVFDDDSGPDMASVAEELGMAPADVVEAIAESTFTIALLGAAMAPMMDGLKVPGPVRRR
FT                   AEPRTDVAPGAIMIAGTNAIIQPFPGPTGWRVVGRTPHTIVDISRPDPVSFGTGDIVRF
FT                   VPVTRDEACALDAGFLLPTEEAV"
     atgaccacag cacagtacgg cgccatcacc gtcgagccct tcggggactc ggcggtgatg        60
     gtgaccatcc cccatgccga ccaggccatc cgaagggccg ggatcgtggc cttccgcgac       120
     cggttcttgg cacaccgccc gcacggtgtg ctcgacgttg tctctggtct cgaatccctg       180
     ctcatcgagt tcgacccgat gcagaccgcg ctcgagcacg tggagtacgc ggctcgtctg       240
     gtggcgcggt gggcgccgtc gcccacggac ggcccggccc gccggcgggc ggtgcggaca       300
     ttcgccatcc ccgtcgtctt cgacgacgac agcggccccg atatggcgtc cgtcgccgaa       360
     gaactgggca tggcccccgc cgacgtcgtc gaggcgatcg cggagtccac cttcacgatc       420
     gccctgctcg gtgcggcgat ggccccgatg atggacgggc tcaaggtgcc cggaccggtg       480
     cgtcggcggg ccgaaccacg gacggacgtc gcccccggag caatcatgat cgccgggacc       540
     aacgcgatca tccagccgtt ccccggcccg accggctggc gggtggtcgg gcgtactccg       600
     cacaccatcg tcgacatctc ccgcccggac cccgtctcgt tcggcaccgg cgacatcgtg       660
     cgcttcgtcc ccgtcacgcg ggacgaggcg tgcgcgctgg acgccggctt cctgctgccg       720
     acggaggagg ccgtatga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page