(data stored in ACNUC7421 zone)

EMBL: CP002047.PE104

CP002047.PE104       Location/Qualifiers
FT   CDS_pept        complement(94511..95320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00104"
FT                   /product="lactam utilization protein"
FT                   /note="COG1540 Uncharacterized proteins, homologs of lactam
FT                   utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03225"
FT                   /db_xref="GOA:D7BUN4"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN4"
FT                   /protein_id="ADI03225.1"
FT                   /translation="MGINSVAVVADLGESFGNYTIGDDGALLTLVTSSNIACGFHAGDP
FT                   RIMDRTVADCVERGIELGAHPGYPDLVGFGRRLIEATEEEIRTDVLYQLGALDAFARVH
FT                   GGTISHVAPHGRMGSIAQTDAKHARAITDAIAAYNTDYIVICQRGLLAEESRKRGLEVG
FT                   YVFLADRGYGDDGMPVPRSHEGGLIYDPELIGERSAQVVREGTVRSVSGNVVPLGHDAD
FT                   VLLLHGDHPTVLANGTALRAALDAADIRVAGLREVLAEKAQVALAAG"
     atgggaatca actccgtagc cgtcgtcgcc gacctcggcg agagcttcgg caactacacg        60
     atcggcgacg acggcgcctt gctcaccctc gtcacctcgt cgaacatcgc ctgcggcttc       120
     cacgccggtg acccgcgcat catggaccgg accgtcgccg actgtgtcga gcgcggcatc       180
     gaactggggg cccaccccgg ctaccccgac ctggtcggct tcggccgccg gctcatcgag       240
     gcgaccgagg aggagatccg caccgacgtc ctctaccagc tcggcgcgct cgacgccttc       300
     gcgcgggtgc acggcggcac catcagccac gtcgccccgc acggccgcat ggggtcgatc       360
     gcgcagaccg atgccaagca cgcccgggcc atcaccgacg cgatcgccgc gtacaacacc       420
     gactacatcg tcatctgcca gcgcggtctg ctcgccgagg agtcgcgcaa gcgcggtctg       480
     gaggtcggct atgtgttcct ggccgaccgc ggttacggcg acgacggcat gcccgttccg       540
     cgctcccacg agggcggact gatctacgac cccgagctga tcggcgagcg ctccgcgcag       600
     gtcgtacggg agggcaccgt ccgctcggtc agcggcaatg tggtcccgct cggccacgac       660
     gccgatgtcc tgctcctgca cggcgaccac ccgaccgtcc tcgcgaatgg caccgcgctg       720
     cgcgccgcgc tcgacgccgc ggacatccgg gtcgccggtc tgcgcgaggt cctggcggag       780
     aaggcgcagg tcgcgctcgc cgccggctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page