(data stored in ACNUC7421 zone)

EMBL: CP002047.PE108

CP002047.PE108       Location/Qualifiers
FT   CDS_pept        complement(99257..100210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00108"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03229"
FT                   /db_xref="GOA:D7BUN8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN8"
FT                   /protein_id="ADI03229.1"
FT                   /translation="MLLRQLEYLVALARARHFAKAAQACFVSQPALSEGIRKLEEELGI
FT                   PLVQRGRRFDGFTPEGERVVLWAQRILADRDAMRGEIQALRAGLSGRLRIGTVPTASTA
FT                   VALLTQPFCAANPLATVQVFADLQAEDIVNRLRTYELDAAVTYHSSVAAHDFKFVPLYR
FT                   ERHVLLTQRSAPDSGAAEISWEEAAQYPLCLLHPMMQGRQVLDAVFETVGVSVTPRVET
FT                   DSIASLFAQVRAGQWASIVPHAWLHVFGVPGGMRAVPLVRPVRTERIGLVLPAREPVSV
FT                   IGQALIDVVERAGIAATLERLPHQAPGDDTPFGVQG"
     gtgctgctgc gccaactcga atacctcgta gccctcgccc gcgcccgcca cttcgcgaag        60
     gcggcccagg catgctttgt ctcccagccg gccctgtccg agggcatccg gaagctggag       120
     gaggaactcg gcatccctct ggtccagcgg gggcgtcgtt tcgacggctt cacaccggag       180
     ggcgagcggg tcgtcctgtg ggcacagcgc atcctcgccg accgtgatgc gatgcggggc       240
     gagatccagg cgctgcgggc ggggctcagc ggccggctgc gtatcggcac cgtcccgacc       300
     gcgtccacgg cggtcgcgct gctgacccag ccgttctgcg ccgccaaccc gctggccacc       360
     gtccaggtct tcgccgacct gcaggccgaa gacatcgtga accggctgcg gacgtacgaa       420
     ctcgatgccg ccgtcaccta ccacagctcc gtcgccgcgc acgacttcaa gttcgtaccg       480
     ctgtaccggg aacgccatgt gctgctgacc cagcggtccg cacccgactc cggcgccgcc       540
     gagatctcct gggaggaggc cgcccagtac cccctgtgtc tgctgcaccc catgatgcag       600
     ggccgtcagg tgctcgacgc ggtgttcgag accgtgggcg tatctgtgac cccgcgggtc       660
     gagaccgact cgatcgcctc cctgttcgca caggtcagag ccggtcaatg ggcgagcatc       720
     gtgccgcacg cctggctgca tgtcttcggt gtgcccgggg gtatgcgcgc cgttccgctg       780
     gtccgcccgg tccgtacgga gcgcatcggc ctggtgctcc cggcccgtga gccggtctcc       840
     gtgatcgggc aggcgctgat cgacgtcgtg gagcgggccg gcatcgccgc cacactggaa       900
     cggctgcccc accaggcgcc gggcgacgac accccgttcg gcgtgcaagg ttag             954
//

If you have problems or comments...

PBIL Back to PBIL home page