(data stored in ACNUC7421 zone)

EMBL: CP002047.PE109

CP002047.PE109       Location/Qualifiers
FT   CDS_pept        100397..102694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00109"
FT                   /product="oxidoreductase alpha subunit"
FT                   /note="COG0243 Anaerobic dehydrogenases, typically
FT                   selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03230"
FT                   /db_xref="GOA:D7BUN9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUN9"
FT                   /protein_id="ADI03230.1"
FT                   /translation="MRDFDEPDQDELSVTAPKTWATGAPAVVHALQYALGQTSPKRTAL
FT                   TLLNINQAKGFDCPGCAWPEPAPGKRHRNEYCENGAKHISDEATSRRVTAEFFRQHSVD
FT                   ELSRKSDYWLNQQGRLTEPMVLREGATHYEPIGWDEALDLLADELRALDHPDEALFYTS
FT                   GRLANEPAFLLQLFARAFGTNNLPDCSNMCHESSGSALNETLGIGKGSVSLDDLYNADL
FT                   IFVVGQNPGTNHPRMLSALEETKRRGGHVVAVNPLPEAGLLRFKHPQKARGIIGRGTDI
FT                   ADQFLQIRPGGDLALFQALNLLLLEAEDKEPGTVLDREFIESHTTGYDAFAEHIRETSW
FT                   DAVLEATGLSRDEIEQVHERVLACRSVIVCWAMGLTQHKHGVPTIREVVNFLLLRGNIG
FT                   RPGAGVCPVRGHSNVQGDRTMGIWERMPQPFLDRLGREFRFTAPTKHGLDSVDSIRAML
FT                   DGRAKLFVGVAGNFVRATPDSEVTERALRNCRLTAHISTKLNRSHAVCGRTALILPTLG
FT                   RSDRDVQAGGEQFMTVEDSMSEVHATRGRLAPASAHLLSEVSIISRLARKVLGSEPDIP
FT                   WADFEADYDLVRDRIARVVDGFENFNERVRRPGGFHLPNPVNEKVFRTPAGKAVFTVND
FT                   FTMLQAPEGHLVLQTLRSHDQWNTIPYAMDDRYRGIKGGRRVVLVNRADLADLGLDDGS
FT                   LVDLVSVWTDGSERRADGFRVVAYPTPRGSAAAYYPETNVLVPLDSVADISNTPTSKSV
FT                   IVRLERAAGATR"
     atgcgggatt tcgacgaacc ggaccaggac gagctgtcgg tgacggctcc caagacatgg        60
     gcgaccggcg ctcccgcggt cgtacacgcg ctgcagtacg cgctcggaca gacgtcgccc       120
     aagcgcaccg cgctgaccct gctcaacatc aaccaggcga agggcttcga ctgcccgggc       180
     tgtgcctggc cggagccggc gccgggcaag cggcaccgca acgagtactg cgagaacggc       240
     gccaagcaca tcagtgacga ggccacctcc cggcgggtga cggccgagtt cttccggcag       300
     cactcggtgg acgagctgag ccgcaagtcg gactactggc tcaaccagca gggccggctg       360
     accgaaccga tggtgctgcg cgagggcgcg acccactacg agccgatcgg ctgggacgag       420
     gcgctggacc tgctcgccga tgagctgcgt gccctggacc acccggacga ggcgctgttc       480
     tacacctccg ggcgactggc gaacgaaccg gccttcctgc tccagctctt cgcgcgggcc       540
     ttcggcacca acaacctgcc ggactgctcc aacatgtgcc atgagtccag cggctcggcg       600
     ctgaacgaga ccctgggcat cggcaagggc agcgtcagcc tcgacgacct ctacaacgcg       660
     gacctgatct tcgtcgtggg gcagaacccg ggcaccaacc acccgcgcat gctgtccgcg       720
     ctggaggaga caaagcgccg cggcggccac gtcgtcgccg tcaatcccct gcccgaggcg       780
     gggctgctcc gcttcaagca cccgcagaag gcacgcggga tcatcggccg cggcacggac       840
     atcgccgacc agttcctgca gatacggccc gggggcgacc tggccctgtt ccaggcgctg       900
     aacctgctgt tgctggaggc cgaggacaag gagccgggca ctgtcctgga ccgcgagttc       960
     atcgagtcgc acaccacggg ctacgacgcc ttcgcggagc acatacgcga gacgtcctgg      1020
     gacgccgtgc tggaggccac cggcctgagc agggacgaga tcgagcaggt acacgagcgg      1080
     gtgctggcct gccgcagtgt catcgtctgc tgggcgatgg gcctgaccca gcacaagcac      1140
     ggcgtgccca ccatccgcga ggtcgtcaac ttccttctgc tgcgcggcaa catcggccgt      1200
     ccgggcgcgg gagtgtgccc ggtgcgcgga cacagcaatg tgcagggcga ccgcaccatg      1260
     ggcatctggg agcgcatgcc ccagccgttc ctcgaccggc tgggacggga gttccgtttc      1320
     accgcgccga cgaagcacgg cctggactcc gtcgactcca tccgggccat gctcgacgga      1380
     cgcgccaagc tgttcgtcgg agtcgcgggc aacttcgtca gggcgacgcc cgacagcgaa      1440
     gtcaccgagc gagccctgcg caactgccgt ctgaccgcac acatttcgac gaagctcaac      1500
     cgctcccacg cggtgtgcgg acgcaccgcc ctgatcctgc ccaccctcgg gcgcagtgat      1560
     cgcgacgtcc aggcgggcgg cgagcagttc atgacggtcg aggactcgat gagcgaggtg      1620
     cacgcgacgc gcggccgtct cgcccccgcg tccgcacacc tgctcagcga ggtgtccatc      1680
     atcagccgcc tcgcccgcaa ggtcctggga tccgaaccgg acatcccctg ggcggacttc      1740
     gaggccgact acgacctcgt ccgcgaccgc atcgcccggg tcgtcgacgg cttcgagaac      1800
     ttcaacgagc gggtacggcg cccaggcggt ttccacctgc ccaacccggt caacgagaag      1860
     gtgttccgca cgcccgccgg gaaggccgtc ttcaccgtca acgacttcac catgctccag      1920
     gcgcccgagg gtcacctggt cctgcagaca ctgcgctcgc acgaccagtg gaacacgatt      1980
     ccgtacgcga tggacgaccg ctaccggggc atcaagggcg gccggcgcgt cgtcctggtc      2040
     aaccgcgccg acctcgcgga cctcggcctc gacgacggca gcctcgtcga tctcgtcagc      2100
     gtctggaccg acggctcgga gcgccgtgcc gacggcttcc gcgtcgtcgc ctacccgacg      2160
     ccccggggtt cggcggccgc ctactacccg gagaccaacg tccttgtgcc gctcgacagc      2220
     gtcgcggaca tcagcaacac gcccacgtcg aagagcgtga tcgtccgcct ggaacgggcc      2280
     gccggggcga cacgttga                                                    2298
//

If you have problems or comments...

PBIL Back to PBIL home page