(data stored in ACNUC7421 zone)

EMBL: CP002047.PE11

CP002047.PE11        Location/Qualifiers
FT   CDS_pept        9020..9520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03132"
FT                   /db_xref="GOA:D7BSV5"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV5"
FT                   /protein_id="ADI03132.1"
FT                   /translation="MLARMDWLPLISTLAGAAIGIVATLIADRSRWRREDAKEAVRLRL
FT                   EVYTQYTTVVKVLGETLRALREQEHPSDEERVVALREAFRESGIAVASERMWLIGPQPV
FT                   VKASNSVFHCLRSICDGYIDGTAVGSPEDHARWEARGKAAAKMRKLMREDLGVGPLLER
FT                   HSS"
     atgctggccc gcatggattg gttgccgctg atttccaccc tggccggggc tgcgatcggt        60
     atcgtcgcca cactcattgc ggatcgaagt cggtggaggc gcgaggatgc caaagaggca       120
     gtccgcctac ggcttgaggt ctatacgcag tacacgaccg tcgtgaaagt cctaggcgag       180
     acattgcggg ctttgaggga gcaagagcac ccttcggatg aagaacgggt tgttgcgcta       240
     agggaagcct tccgggagtc gggcatagcc gtcgcatctg aacggatgtg gcttatcggg       300
     cctcaacccg tggtcaaggc gtccaatagc gtcttccact gtctccggag catttgcgac       360
     ggttacatcg acggcacggc tgttggcagt ccggaagatc acgcacgctg ggaggcgcgt       420
     ggcaaggctg ccgccaagat gcgcaagctg atgcgcgagg atcttggcgt tggcccgctc       480
     ctcgaacgtc acagcagtta g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page