(data stored in ACNUC7421 zone)

EMBL: CP002047.PE110

CP002047.PE110       Location/Qualifiers
FT   CDS_pept        complement(102711..103661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00110"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03231"
FT                   /db_xref="GOA:D7BUP0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP0"
FT                   /protein_id="ADI03231.1"
FT                   /translation="MDLTAVRTFVTAVDAGQFQEAATNLSITPQAVSKRIAVLEKDLGV
FT                   QLFSRTARGARLTIDGQAFLPYARALLQAEERAAASVRPGRRALRVDVIRYRVSVAGLL
FT                   RDFHRAYPETELDVLTLFDYDTAIAAVRSGTIDATFRAVTMPGRQLPDGVEATPVFDEP
FT                   LYLFTGPAHEFAGARAIAPAQLAGRRIWMPGNMPGTEWAAYYDELAATFGLTIDAVGPN
FT                   FGVEHLLDTIADSTTLATFVSEQTPLVWPAGHDLRHIPLHEPTPVYPHSLIWRTDNPHP
FT                   ALAALRHHLTSAYPGRANDGIWTPKWAQPAQPERA"
     atggatctca ctgccgtgcg caccttcgtc accgccgtgg acgcgggaca gttccaagaa        60
     gccgccacca acctgtcgat caccccacag gctgtgtcca agcgcatcgc cgtgctggag       120
     aaggacctcg gtgtgcagct gttcagccgt acggcccgcg gagcccggct caccatcgac       180
     gggcaggcgt tccttcccta cgcccgggcc ctcctccaag ccgaggaacg ggcagccgct       240
     tccgtacgcc cagggcgccg ggcgctgcgc gtcgacgtga tccgctaccg ggtctcagtg       300
     gcgggtctgc tgcgagactt ccaccgtgcg tatcccgaga ccgagcttga tgtcctgacc       360
     ctgttcgatt acgacacagc cattgccgcc gtccggtccg ggacgatcga cgcgacgttc       420
     cgagccgtga ccatgccggg ccggcagctt cccgacggtg tcgaggccac tccggtcttc       480
     gacgaaccgc tgtacctgtt caccgggccg gctcatgagt tcgccggcgc ccgcgcgatc       540
     gctcccgccc agctcgccgg gcgccggatc tggatgcccg gcaacatgcc cggcaccgag       600
     tgggccgcct actatgacga actcgccgcc acgttcggtc tcaccatcga cgcggtcggc       660
     ccgaacttcg gtgtcgagca tctgctcgac accatcgcgg actccacgac gctggccacc       720
     ttcgtcagcg agcagacccc gcttgtctgg cccgccggcc acgatctgcg acacatcccc       780
     ctgcacgaac cgacaccggt ctacccccac tcactgatct ggcgcaccga caacccccac       840
     cccgccctgg ccgccctgcg ccaccatctc acctccgcct atcccggccg cgccaacgac       900
     ggcatctgga cgccgaaatg ggcccagccc gctcagccag aacgcgcatg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page