(data stored in ACNUC7421 zone)

EMBL: CP002047.PE112

CP002047.PE112       Location/Qualifiers
FT   CDS_pept        complement(107554..107991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03233"
FT                   /db_xref="GOA:D7BUP2"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP2"
FT                   /protein_id="ADI03233.1"
FT                   /translation="MGVMLAIPGFGTAEARNHGAGLDLYLVLLFVISEALGLLTLGLVQ
FT                   PWGEAVPRWIPLLGGRRIRPLAAVVPAALGALASTGVVYYFFLSILFGGFPAGHTTPEE
FT                   VILTVCYLPLLAWGPLLGSVTYAYYRRRTSSQGQHTPTPSP"
     atgggggtga tgctggccat acccggcttc ggcacagctg aggcccgcaa ccacggcgcc        60
     gggctcgatc tgtatctggt gctgctcttc gtcatttccg aggcactcgg gttactcacc       120
     ctgggactgg tccagccgtg gggcgaggcg gtgccgcgct ggatacccct gctgggcggg       180
     cgccgcatcc gcccgctcgc cgcggtggtc ccggccgcgc tgggcgcact cgcctccacg       240
     ggggtcgtgt actacttctt tctctccatc ctcttcggag gatttcccgc cggacacacg       300
     acccctgaag aggtcatttt gacggtctgt tatctgccgc tgctcgcctg ggggccgctt       360
     ctgggatcgg tgacgtacgc ctactaccgc cgacgcacca gcagccaggg acagcacacg       420
     cccactccct cgccctga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page