(data stored in ACNUC7421 zone)

EMBL: CP002047.PE113

CP002047.PE113       Location/Qualifiers
FT   CDS_pept        complement(108317..108802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00113"
FT                   /product="hypothetical protein"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03234"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP3"
FT                   /protein_id="ADI03234.1"
FT                   /translation="MSVEADIPSLVGVHHLKLPVRDLARSEEWYGRTLGYRRAAEFVEQ
FT                   GVLIEVVLSHPAGGPDLALRLDPGRAEAAAGFDYFAIAVPDSAAIEALAARMEALGEPH
FT                   GGVWRGLRGWVLPRLHDPDGHEVRFYTVEEHTSHEPGEVMRMVDPLESAEQVRPAAP"
     atgagcgtgg aagctgacat cccgagcctc gtcggcgtcc accacctcaa gctgccagta        60
     cgcgatctcg cccgctccga ggagtggtac gggcgcacgc tcggctaccg gcgggctgcc       120
     gagttcgtcg agcagggggt gttgattgag gtcgtgctga gccatccggc cggcgggccg       180
     gacctggcgc tgcggctcga cccgggccgg gccgaggctg ccgccggctt cgactacttc       240
     gcgatcgcgg tacccgacag cgccgcgatc gaggcgctcg ccgctcgtat ggaggcccta       300
     ggtgagccgc acggcggcgt ctggcgcggg ctgcgtggat gggtgctgcc aaggctgcat       360
     gaccccgacg gtcacgaggt gcgtttctac accgtcgagg aacacacctc gcacgagccc       420
     ggcgaggtca tgcgcatggt ggacccactg gagagcgccg agcaggtgcg gcccgccgcg       480
     ccgtag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page