(data stored in ACNUC7421 zone)

EMBL: CP002047.PE115

CP002047.PE115       Location/Qualifiers
FT   CDS_pept        110670..111338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00115"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="COG2755 Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03236"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP5"
FT                   /protein_id="ADI03236.1"
FT                   /translation="MTITVRPGSTVMFTGDSITDCQRLESEDGLGFGYPLRVAGEWGLR
FT                   HPDRPVTWLNTAHAGDKVMDLEARWQTDVLDARPDVVSILVGVNDMGWHTLDPKGYVIP
FT                   AEEFEAGYDRLLTPLAEAGTKLILIEPFLLPIHGVVEAGAGVALIGEKERKEWRTDLDP
FT                   KIQVVRKLARKYGAHLLDADGMFAELAATTEPEYWAADGVHPTPAGHAALAAAWLRLVA
FT                   "
     atgacgatca ctgtccgacc gggaagcacc gtgatgttca ccggagattc gatcaccgac        60
     tgccaacggc tggaaagcga agacggtctc gggttcggct acccgcttcg cgtcgcgggc       120
     gagtggggac tcaggcaccc ggaccggccc gtgacctggc tgaacaccgc gcacgcgggc       180
     gacaaggtga tggacctcga agcccgctgg cagacagacg tactcgacgc gcgcccggac       240
     gtggtgtcga tcctcgtcgg ggtcaacgac atgggctggc acacgctgga ccccaagggg       300
     tacgtgatcc ccgccgagga gttcgaagcg ggttatgacc gcctgctcac gcccctcgcc       360
     gaggctggca cgaagctgat cctcatcgag ccattcctcc tgccgatcca cggcgtcgtc       420
     gaggccggtg ccggtgtcgc gctcatcgga gagaaagagc gaaaggagtg gcgcaccgac       480
     ctggacccga agatccaggt cgtgcgcaag ctcgcccgca agtacggcgc gcatctgctc       540
     gacgccgacg gcatgttcgc cgagctcgcc gcgacgaccg agccggagta ctgggccgcg       600
     gacggcgtac acccgacgcc ggccggtcac gccgcactcg cggcggcctg gctgcgcctg       660
     gtcgcgtga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page