(data stored in ACNUC7421 zone)

EMBL: CP002047.PE119

CP002047.PE119       Location/Qualifiers
FT   CDS_pept        complement(112761..113186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00119"
FT                   /product="hypothetical protein"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03240"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUP9"
FT                   /protein_id="ADI03240.1"
FT                   /translation="MFTQLQALPHRHVLTLPSAPAAVRSARETAEQALVEWGIGLRHPV
FT                   VGPALLILSELVTNSVRHAAELSPQLTVIYAASDVHLAFSVHDRHPYQPPLSELANSTG
FT                   TSGLATVMELTFALEGTAVIRGDTDGQGKSIWITLPL"
     atgttcacac agctccaagc cctgccccac cgacatgtgc tcacgctgcc cagcgcaccc        60
     gccgccgtcc gcagcgcccg cgagactgcc gagcaggccc tggtcgagtg ggggatcggt       120
     ctgcgccacc ccgtggtggg cccggccctg ctgatcctca gtgagctggt caccaacagt       180
     gtccggcacg ccgccgagct ctccccgcag ctcaccgtga tctacgcggc gagcgacgtc       240
     cacctggcct tctccgtcca cgaccgccac ccctaccagc cgccgctgtc cgagctcgcc       300
     aacagcaccg ggaccagcgg cttggccacc gtcatggaac tcaccttcgc tctggagggc       360
     actgcggtca tccgcggcga caccgatggc cagggcaaga gcatctggat caccctcccc       420
     ctctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page