(data stored in ACNUC7421 zone)

EMBL: CP002047.PE122

CP002047.PE122       Location/Qualifiers
FT   CDS_pept        complement(115309..115866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00122"
FT                   /product="hypothetical protein"
FT                   /note="COG2353 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03243"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ2"
FT                   /protein_id="ADI03243.1"
FT                   /translation="MYGFGPSTGRLLIKTSRIGLGRKAGHDLTIEATRWSGKAVVVADD
FT                   PGKSSVTVEVETGSLIVREGAGGLKPLADADRAQIKRTLEGEALLHASRHPAIVFRSTG
FT                   ITGTLQSFEITGDLTIKGRTHPATVHGGSDGNGMVCGRGTVTQSTWGIKPYTAFLGTLK
FT                   LADEVRIEYAVTELERLPDPDG"
     gtgtatggtt tcgggccgtc gaccggccgc ctgctgatca agaccagccg catcggcctc        60
     ggccggaagg cgggtcacga cctcaccatc gaggccaccc gatggtccgg gaaggcggtg       120
     gtcgtcgccg acgatcctgg gaagtcatcg gtgaccgtag aggtcgagac gggttcgctg       180
     atcgtccgcg agggggccgg cgggctcaaa cccctcgccg acgccgaccg ggcccagatc       240
     aaaaggacgc tggaaggtga ggctctgctg catgcctcgc ggcaccccgc catcgtcttt       300
     cgttccaccg gcatcacggg aacgcttcag tccttcgaga tcaccggcga cctcaccatc       360
     aagggccgga cacacccggc gaccgtgcac ggcggcagcg atgggaacgg aatggtgtgc       420
     gggcgcggaa ccgtcaccca atccacctgg gggatcaagc cgtacacagc gttcctgggc       480
     acgctgaaac tggccgacga agtccggatc gagtatgcgg tgaccgaact cgaacggctg       540
     cccgacccgg atggctga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page