(data stored in ACNUC7421 zone)

EMBL: CP002047.PE124

CP002047.PE124       Location/Qualifiers
FT   CDS_pept        116925..118352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03245"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ4"
FT                   /protein_id="ADI03245.1"
FT                   /translation="MTVLAALLDRSVEQIAKAAADVRRYDREAIRAASDVWDNNLFPLF
FT                   WAASTASADKRERRALTALEWMAGLGERRRGWMTEQAALAGYELEPLLPPAKPDTPGRD
FT                   YRGYVMTPACRLAQPTVDDLVPDYDLATAAVRHLRVERAGTRLTAFLQLVAPRRYAVDE
FT                   STPTQPALLNVALDGVTDAVFDLSATRGAALDPGAGGIEISLGTGGRLRAASGEYRLDD
FT                   HSWHLSAAGRRADAVTPPRTGRSDRLPPPPAGDLGADARAAAILLRHAMWELRSVRYAA
FT                   RADRVPVLDLCQAFAGAGEAILAAGSRRGAARREAAFRDVIRTWADRSGPALTRWIAAV
FT                   LKERADRPDIIEMPRSPERTPPSLTAGSPVFGTPSQAALVMAAWTAAHTDYRTERPAAA
FT                   VLQLALPPRPDEPPSAPWRLRTVSCTEPDAFRLHTDAFQGPGQLTQTGRPTAACSLDLH
FT                   HGAMVIAAPDGWSASVS"
     atgacggtgc tggcggccct cttggaccgc tcggtcgagc agatcgctaa ggccgcggcg        60
     gacgtccgcc gctatgaccg ggaagcgatt cgtgcggcgt cggatgtgtg ggacaacaac       120
     ctctttccgc tgttctgggc agcgagcacg gccagcgccg acaagcgcga gcgtcgggct       180
     ctgaccgcgt tggagtggat ggccggtctc ggcgagcggc ggcgcgggtg gatgaccgag       240
     caggccgcac tcgcggggta cgaacttgaa ccgctcctgc cgccggccaa gccggacaca       300
     ccaggccgtg actaccgcgg atacgtcatg acaccggcat gccggctcgc acaaccgaca       360
     gtggatgacc tggtccccga ctacgacctg gcgacggcgg ccgtccgcca ccttcgagta       420
     gagcgcgccg gtactcgctt gaccgccttc ctccagttgg tcgcgccccg caggtacgca       480
     gtcgacgaga gcacgcccac gcaacctgcc ctgctgaacg tggcgctgga tggcgtcacc       540
     gacgccgtct tcgacctctc cgccacccgg ggagcggccc tggaccccgg tgcgggcggg       600
     attgagatat ctctgggcac gggcggccgg ctccgcgccg caagcggcga gtaccgcctt       660
     gacgaccact catggcacct gtcggccgcc ggccgacgcg ccgacgcggt caccccgccc       720
     cgcaccggcc ggtcggaccg cctgcctccg ccgcccgccg gagacctggg tgccgacgcc       780
     cgggccgccg cgatccttct gcgccacgcc atgtgggagc tccgctcggt gcgttacgcc       840
     gcccgtgccg atcgtgtccc ggtgctcgac ctgtgccagg ctttcgcagg agcgggtgaa       900
     gcgatcctgg ccgcgggatc gcggcgcggc gccgcccgcc gtgaggcggc cttccgtgac       960
     gtgatccgca cctgggccga ccggagcggc ccggctctca cccgctggat cgccgccgtt      1020
     ctcaaggagc gcgccgatcg tccggacatc atcgagatgc cccggtctcc cgaacgaaca      1080
     cccccctccc tcaccgccgg ctcacccgtg ttcggcacgc cctcgcaggc agctctcgtc      1140
     atggcggcct ggacggcggc gcacaccgat taccgcacag agcgtccggc cgccgcggta      1200
     ctccaactcg ccctgccgcc ccgccccgac gagcccccct cagcaccctg gcggctacgt      1260
     accgtcagtt gcaccgagcc cgacgccttc cgccttcaca ccgacgcctt ccaggggccc      1320
     ggccaactca cccaaacagg gaggcccact gccgcctgca gcctcgatct gcaccacgga      1380
     gccatggtca tcgccgctcc agatggctgg agtgcgtcag tcagctga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page