(data stored in ACNUC7421 zone)

EMBL: CP002047.PE127

CP002047.PE127       Location/Qualifiers
FT   CDS_pept        120072..121196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00127"
FT                   /product="putative DNA alkylation repair protein"
FT                   /note="COG4335 DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03248"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ7"
FT                   /protein_id="ADI03248.1"
FT                   /translation="MPTADELISPDSIRQLAAILQDTSPSTSRWQTVADSSTALGSLGL
FT                   SERARTVGDALLADSGPDYPRLAGAVRKALRREDLTGWMIWPVTEAVATAATTSGTTEH
FT                   FDDGLALLAQLTPRLTGEFALRTFLNTDLERTLATASTWTGSPDPAVRRLASEGTRPKL
FT                   PWARQVPELNRNPQATVPLLGELHTDTSADVRRSVANHLNDISRLDPHLAARTAAQWMD
FT                   HPAAPTTPALVRHAMRTLVKKGDPKALELVGFHGSRENLQVTGPLLTDTAIPAGGTLTF
FT                   TAHIKNVSDQPVSLAIDYVIHHKKANGKLAPKVFKLTKRNLTPGESADLTRRHSFRPIS
FT                   TRVYYPGTHAVQLQVNGQQHGLVEFDLGGTEARS"
     gtgcccaccg ccgatgagct gatcagccct gacagcatcc gccagctagc cgccatcctc        60
     caggacacct cgccctccac ctcgcgctgg cagaccgtcg cggacagctc caccgcgctc       120
     ggctcgctcg ggctcagcga gcgggcgcgc accgtgggcg acgcgttgct ggccgactcc       180
     ggccccgact acccgcgcct ggcgggcgcc gtacgcaagg ccctgcgacg cgaggacctg       240
     acaggctgga tgatctggcc cgtcaccgaa gccgtcgcca cggcggccac cacatccggc       300
     accaccgagc acttcgacga cggcctcgct ctgctggcac agctcacccc gcgcctgacc       360
     ggcgagttcg cactgcgcac cttcttgaac accgacctgg aacgcaccct ggccacagca       420
     tcgacgtgga ccggctcccc cgaccccgca gtgcgccggc tggccagcga gggcacccgc       480
     cccaaactgc cctgggcccg acaggtcccc gaactcaacc gcaaccccca agccaccgtc       540
     cccctgctgg gggaactaca caccgacacc tccgcagacg tacgccgctc ggtggccaac       600
     cacctcaacg acatctcccg cctggacccc cacctcgccg ccaggacagc cgcacaatgg       660
     atggaccacc ctgcggcgcc caccacgccc gccctggtac gccacgccat gcgaaccctc       720
     gtcaagaagg gcgacccgaa agccctggaa ctggtcggct tccacggcag ccgcgaaaac       780
     ctccaggtga ccggcccgct gctgaccgac accgccatcc ccgcaggcgg caccctcacc       840
     ttcaccgcac acatcaagaa cgtctccgac cagcccgtct ccctggccat cgactacgtc       900
     atccaccaca agaaggcgaa tggaaagctg gcacccaagg tgttcaaact caccaaacgc       960
     aacctgaccc ctggggaatc cgccgacctg acacgccgcc actctttccg ccccatcagc      1020
     acccgggtgt actaccccgg aacccacgcc gtgcagctcc aggtcaacgg ccagcagcac      1080
     ggcctggtgg agttcgacct cgggggaacc gaggcgcggt cctga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page