(data stored in ACNUC7421 zone)

EMBL: CP002047.PE128

CP002047.PE128       Location/Qualifiers
FT   CDS_pept        121493..123142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00128"
FT                   /product="putative integral membrane protein"
FT                   /note="COG1457 Purine-cytosine permease and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03249"
FT                   /db_xref="GOA:D7BUQ8"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ8"
FT                   /protein_id="ADI03249.1"
FT                   /translation="MSTTESPLKTTGTTRTTTDQAVKETLEDYTLRFAPRSYRRWTPMV
FT                   VATTALGGIAYMADFSIGAGIGLAHGTGNALVAIAVAAVVIFITGFPLAYYGARYNIDL
FT                   DLITRGSGFGYYGSVLTSVIFASFTFIFFALEGSIMAQGLKLGLGLPLWLGYLVSTLMV
FT                   IPLVIYGMKALSKLQVWTTPIWLLLMVGPLVYLVTTDPGTIDRFLAYAGTDGDGGVNTA
FT                   SVLLGAGVCLSLIAQIGEQIDYLRFMPPKTEANKRGWWTAVIMAGPGWVVLGALKQAIG
FT                   VFLAVYILAKVGPAAATEPIQQFRGAFDAMMPSWMVIPLAVALVVISQIKINVTNAYSG
FT                   SLAWTNSFTRVTKHYPGRMVFVLVNLGFALALMEADMFSFLNDILGFYSNCAIAWVVTV
FT                   ATDIGINKYLLKISPLQPEFRRGMLHAVNPVGVVAFVAASGLSIAMYFHLLGDTLQPYS
FT                   PVAAAVIAFVLTPLVAIITKGRYYLRRTDDGIAEPLLDPDGNPSSLTLDCHVCHQSYER
FT                   PDLTACATHDAVVCSLCLSTDKVGDHVLPGIA"
     atgagcacca ccgagtcacc gctgaagaca acaggcacga cgaggaccac cactgaccaa        60
     gcggtcaagg agaccctgga ggactacacc ctccgtttcg ctccccgcag ttaccgccgc       120
     tggaccccga tggtcgtggc caccaccgca ctcggcggca tcgcctacat ggccgacttc       180
     tccatcggcg ccggcatcgg gctggcgcac ggcacgggca acgcgctggt ggcaatcgcg       240
     gtagccgctg tggtcatctt catcaccggc tttccgctcg cctactacgg tgcccgctac       300
     aacatcgacc tggacctgat cacgcgcggc tccggcttcg gctactacgg ctcggtgctg       360
     accagtgtca tcttcgccag cttcaccttc atcttcttcg ccctcgaagg ctcgatcatg       420
     gctcagggcc tcaagctcgg cctcgggctt ccgctgtggc tgggctatct cgtctccacg       480
     ctcatggtca tccctctggt gatctacggc atgaaggcgc tgagcaagct ccaggtgtgg       540
     accaccccga tctggctgct gctcatggtc ggcccgctgg tctacctggt caccaccgac       600
     cccggcacga tcgaccgctt cctggcctac gccggcacgg acggcgacgg cggcgtcaac       660
     acggcctccg tactgctcgg tgcgggcgtg tgtctctccc tcatcgcgca gatcggtgaa       720
     cagatcgact acctgcgttt catgccgccc aagaccgagg cgaacaagcg cggttggtgg       780
     accgccgtga tcatggcggg ccccggctgg gtggtgctcg gcgcgctcaa gcaggccatc       840
     ggcgtcttcc tcgccgtgta catcctcgcc aaggtcggcc cggccgccgc gaccgagccg       900
     atccagcagt tccgtggcgc gttcgacgcg atgatgccgt cctggatggt catcccgctg       960
     gccgtggccc tggtcgtcat cagccagatc aagatcaacg tcacgaacgc gtactccggt      1020
     tcgctggcgt ggacgaactc cttcacccgc gtcaccaagc actatccggg ccgtatggtc      1080
     ttcgtcctgg tcaacctggg cttcgcgctg gccctgatgg aagccgacat gttcagcttc      1140
     ctcaatgaca tcctgggctt ctactccaac tgcgccatcg cctgggtcgt caccgtcgcc      1200
     accgacatcg ggatcaacaa gtacctgctg aagatctccc cgctccagcc ggagttccgc      1260
     cgcggcatgc tgcacgccgt caacccggtc ggcgtcgtgg cgttcgtcgc cgcctccgga      1320
     ttgtcgatcg ccatgtactt ccacctcctc ggcgacaccc tccagccgta ctccccggtc      1380
     gccgcggcgg tgatcgcgtt cgtcctcacc ccgctggtgg cgatcatcac caagggcagg      1440
     tactacctgc gccgcaccga cgacggcatc gccgagccgc tcctggaccc cgacggcaac      1500
     ccgagctcgc tcaccctcga ctgccacgtc tgccaccagt cctacgagcg ccccgacctg      1560
     accgcctgcg ccacccacga cgcagtcgtc tgctcactgt gcctgagtac ggacaaggtc      1620
     ggggatcacg tgctgccggg catcgcgtag                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page