(data stored in ACNUC7421 zone)

EMBL: CP002047.PE129

CP002047.PE129       Location/Qualifiers
FT   CDS_pept        complement(123215..123625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00129"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUQ9"
FT                   /protein_id="ADI03250.1"
FT                   /translation="MSTEHAHLPPGVEVIATLPEAAPRIPAGAEARTIRVTLAPGDPGA
FT                   PPHRHPGPLFGYVTQGEILFELEGQPPRVVKAGEALFEPGGDVIHYLGANNLQDAQSQL
FT                   VVTMFAPPGTPILTVVSAEELAERRHLRFGRP"
     atgagcactg agcatgcaca cctgcccccg ggcgttgagg tcatcgcgac cctgccggag        60
     gcggcgcccc ggatcccggc cggcgccgag gccaggacca tccgggtcac cctggcgccc       120
     ggcgaccccg gcgcgccgcc gcaccggcac cccgggccgc tcttcggcta cgtgacccag       180
     ggcgagatcc tcttcgagct ggaggggcag ccgccccgcg tggtcaaggc cggtgaagcc       240
     ttgttcgagc ccgggggcga cgtgatccac tacctgggcg ccaacaacct tcaggacgcg       300
     cagtcgcagc tggtggtgac catgttcgcg ccgccgggta cgccgattct gaccgtggtc       360
     agcgcggagg agctggccga acgacgacac ctgcggtttg gccggccgtg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page