(data stored in ACNUC7421 zone)

EMBL: CP002047.PE13

CP002047.PE13        Location/Qualifiers
FT   CDS_pept        12126..12479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03134"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV7"
FT                   /protein_id="ADI03134.1"
FT                   /translation="MADSGEGQHLLAERFLDQRQLPGPVTSQGFAEPFGVVLDVALAAG
FT                   SLEGSSDLCSGQVRGFDGGGRQLEELACFGSAQAVGPGGEGVPGVGVVLAQWRPELVGD
FT                   LLPVPGRVLLGAG"
     gtggccgata gcggcgaggg ccagcatctg ctggccgagc gcttcctcga ccagcggcag        60
     ctgccgggcc cagtcacctc gcagggcttc gcggagccgt tcggtgtcgt cctcgatgtc       120
     gcgcttgcgg ccggatcgct tgagggcagc agtgatttgt gctcgggtca ggtgcgcggc       180
     tttgacgggg gtgggcggca gcttgaggag ctcgcgtgct tcgggtcggc acaggccgtt       240
     ggtccaggcg gagaaggcgt cccaggcgtc ggggtagtac tcgcgcagtg gagaccggag       300
     ctggttggag acctgctgcc ggttccaggt cgcgtcctgc tgggcgcggg ctag             354
//

If you have problems or comments...

PBIL Back to PBIL home page