(data stored in ACNUC7421 zone)

EMBL: CP002047.PE133

CP002047.PE133       Location/Qualifiers
FT   CDS_pept        128496..129716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00133"
FT                   /product="hypothetical protein"
FT                   /note="COG0531 Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03254"
FT                   /db_xref="GOA:D7BUR3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR3"
FT                   /protein_id="ADI03254.1"
FT                   /translation="MSDAVLIGLGSMIGAGIFASLSPAARAAGSGLLLGLALAAVVAYC
FT                   NATSSARLAARYPASGGTYVYGRERLGEFWGYLAGWSFVVGKTASCAAMALTVGTYIWP
FT                   GQTHTVAVAAVVALTAVNYAGVQKSALLTRVIVAVVLPVLAAVVATCLTSGAVAAARLN
FT                   IGSDAAFGGVLQAAGLLFFAFAGYARIATLGEEVRDPVRTIPRAIPVALGLTLVVYTAV
FT                   AVSVLLVLGSDGLAATGAPLTDAARAAGAAWLVPAVRIGAAVAALGSLLALILGVSRTT
FT                   LAMARDHHLPHALASVHPRFKVPHRAELLVGTVVATVAATADVRGAIGFSSFGVLAYYA
FT                   VANASAWTLSPAEGRPARIIPAVGLAGCLVLAFALPVSSVISGAVVLAVGAAAYAVSRA
FT                   SFRSPPA"
     gtgtcggacg cggtgctgat cggcctgggc tcgatgatcg gtgccgggat cttcgcctcc        60
     ctgtcgccgg ccgcccgcgc ggccggctcg ggtctgctgc tcggcctggc cctcgccgcg       120
     gtcgtcgcct actgcaacgc gacctcctcc gcgcggctcg ccgcccgcta cccggcctcc       180
     ggcggcacct acgtctacgg gcgggagagg ctgggtgagt tctggggtta tctggccggc       240
     tggtcgttcg tagtgggcaa gaccgcctcg tgcgcggcca tggccctgac cgtcggcacc       300
     tacatctggc ccggccagac gcatacggtc gccgtggccg ccgtcgtggc gctgaccgcg       360
     gtcaactacg ccggggtgca gaagtccgcg ctgctgaccc gcgtcatcgt ggccgtcgtc       420
     ctgccggtgc tcgccgcagt cgtggccacc tgcctcacct ccggcgccgt ggccgccgcc       480
     cgcctgaaca tcggctcgga cgccgccttc ggtggcgtgc tgcaggcggc cgggctgctg       540
     ttcttcgcgt tcgccggcta cgcccgcatc gccaccctcg gcgaagaggt ccgcgacccg       600
     gtccgcacca ttccgcgtgc catcccggtc gcgctcggcc tcaccctcgt cgtctatacc       660
     gctgtcgccg tctccgtcct gctcgtcctc ggctccgacg gcctggccgc caccggggca       720
     ccgctgacgg atgccgctcg ggcggccggc gccgcctggc tcgtcccggc cgtacgcatc       780
     ggcgccgcgg ttgccgccct cggctccctg ctcgccttga tcctcggcgt ctcccgcaca       840
     accctggcca tggcccgcga ccaccacctg ccccacgccc tggcgtccgt gcaccccagg       900
     ttcaaggtcc cccaccgggc cgaactcctc gtgggtaccg tcgtcgccac ggtggccgcg       960
     accgcggacg tacgcggagc gatcggtttc tcctccttcg gcgtcctcgc ctactacgcc      1020
     gttgccaacg cctccgcatg gaccctgagc cccgctgagg gccgcccggc ccggatcatc      1080
     cccgcagtcg gcctggccgg ctgccttgta ctggccttcg cactcccggt gtcctccgtg      1140
     atctccggag ctgttgtgct cgctgtcggc gccgccgcct acgccgtctc gcgcgcttcc      1200
     ttccggtcgc ccccggcgta g                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page