(data stored in ACNUC7421 zone)

EMBL: CP002047.PE134

CP002047.PE134       Location/Qualifiers
FT   CDS_pept        129779..130633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00134"
FT                   /product="hypothetical protein"
FT                   /note="COG2513 PEP phosphonomutase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03255"
FT                   /db_xref="GOA:D7BUR4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR4"
FT                   /protein_id="ADI03255.1"
FT                   /translation="MTPNHTLHNQALAFRSRHVPGHPLVLPNAWDATSARIVEDAGAAA
FT                   VATTSAGLAWALGAADGDRLGRDRALGAVARIVDAVRVPVTADIESGYARDSAGVGDTI
FT                   RAVIAAGAVGVNIEDALYEGDALYGSGEGPLRPVAEQAERLAAARQAADEAGAPLFVNA
FT                   RIDTFLSGAGGVDHTLERAAAFLAAGADGVFVPGVVDPVTVKALAEGIDGPLNVMAGPG
FT                   APPVAELAALGVARVSVGSGIAQAAHAVVRRAARELLGAGTYESLTGGLDYGELNALLG
FT                   SGR"
     atgacgccga accacaccct ccataaccag gccctcgcct ttcggtcccg ccacgtcccc        60
     gggcatccgc tcgtcctgcc gaacgcctgg gacgccacga gcgcccgtat cgtcgaggac       120
     gccggggccg ccgcggtggc gaccacgagt gcggggctgg cctgggcgct gggagcggcg       180
     gacggcgacc ggctgggccg cgaccgggcc ctgggcgccg tcgcgcgcat cgtcgacgcg       240
     gtccgggtgc cggtgaccgc agacatcgag agcggctacg cgcgggactc ggccggtgtc       300
     ggcgacacga tccgcgcggt gatcgcggcg ggcgcggtcg gagtgaacat cgaggacgcg       360
     ctgtacgagg gggatgcgct gtacgggagc ggcgagggcc cgctgcggcc ggtcgccgag       420
     caggccgaac gcctcgccgc cgcccgccag gcggcggacg aggcaggcgc gccgctgttc       480
     gtgaacgccc ggatcgacac cttcctcagc ggcgcgggag gagtggacca caccctggaa       540
     cgggcagccg ccttcctcgc cgcgggcgcc gacggggtct tcgtcccggg ggttgtcgac       600
     ccggtgaccg tgaaggcgct cgccgagggc atcgacggcc cgctcaacgt gatggcgggc       660
     ccaggggcac ccccggtcgc cgagctggcc gcgctcggcg tcgcgcgcgt tagcgtcggg       720
     tcgggcatcg cccaggccgc gcatgccgtg gtccgccgcg ccgcgcggga gctgctgggc       780
     gcggggacct acgagtcgct gaccggaggg ctcgactacg gcgagctcaa cgcgctcctg       840
     ggaagcgggc gttag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page