(data stored in ACNUC7421 zone)

EMBL: CP002047.PE135

CP002047.PE135       Location/Qualifiers
FT   CDS_pept        complement(130850..132256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03256"
FT                   /db_xref="GOA:D7BUR5"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR5"
FT                   /protein_id="ADI03256.1"
FT                   /translation="MRAGVFAVLGTVLAAFGHHAIAEGTVPWRLVSCLATAQFAGVWPL
FT                   ARRHCPPAATMLFTLATQGVLHLALSWADGDTQTGTPGHAVHTGHLTAAPGDGHAWHHA
FT                   GTAMTTVHTLAALAVAWLLHRADARMVTALDTLRTLARAAAAALAQALPRPVSGAGRLL
FT                   RLPGRQAWGRDDLPVRAEGEVLKHVVVRRGPPQPERHLPSRAGPDHPRDRSNPWQQGVP
FT                   VPKRPHPPARTARRIALAGAAALTSVLALAAPAAAHAEVEADTPQALAENVTLSFVSEA
FT                   ESDSAGFRELRIVLPDGIASDDVSLADAPKGWRMKATPDGYTVGGPALRPGVNAEHKIK
FT                   VNRLPDAKEIAFKTVETYSDGQVSRWIELPRGGGEPEQPAPVLKLKAAAADAKPVSPSP
FT                   TSSPAPDETSSATADSTSEQDATSAEEKATGESDSVSSGVLIWVIVAVLLVLAGGVWWL
FT                   IRRRVSASQR"
     gtgcgggccg gtgtgttcgc ggtgctcggc acggtgctcg ccgcgttcgg ccaccatgcg        60
     atcgccgaag gaacggtgcc gtggcggctg gtgagctgct tggccacggc gcagttcgcg       120
     ggggtctggc ccctggcccg gcgccactgc ccgcccgccg cgaccatgct gttcacgctg       180
     gcgacgcaag gcgtgctgca cctggcgttg tcctgggcgg acggcgacac gcagacgggg       240
     acaccagggc acgcggtgca caccgggcac ctcacggcgg cgccgggcga cggacatgcc       300
     tggcatcacg ccgggacggc gatgacgacc gtccacacgc tcgccgcgct ggccgtggcc       360
     tggctgctgc accgcgcgga cgcccggatg gtgaccgcgc tggacacgct gcgcaccctg       420
     gccagggccg ccgcggccgc cctggcccag gcgctgccac ggccggtcag cggcgcgggg       480
     cgtctgctcc ggctgcccgg ccggcaggca tggggtcgcg acgacctacc ggtacgggca       540
     gaaggggagg tgctgaagca tgtggtggtg cgcaggggac cgccgcagcc ggagcgccac       600
     ctcccgtccc gcgccggccc cgaccatcca cgggaccggt caaacccgtg gcagcaagga       660
     gtccctgtgc ccaagcgccc gcacccgccc gcccgtacgg cccgccggat cgcactcgcc       720
     ggcgccgccg cgctgacgtc agtcctcgcc ctggccgcac cggccgccgc ccatgcggaa       780
     gtcgaggccg acaccccgca ggccctggcc gagaacgtca ccctgtcctt cgtctccgag       840
     gccgaatccg actcggcggg cttccgcgag ctgcgcatcg tactgcccga cggaatcgcc       900
     tccgatgacg tgagcctcgc cgacgccccc aaggggtggc ggatgaaggc cacccctgac       960
     ggctacaccg tcggcgggcc cgcgctgagg cccggtgtca acgccgaaca caagatcaag      1020
     gtgaaccgac tgccggacgc gaaggagatc gcgttcaaga ctgtggaaac ctacagcgac      1080
     ggccaagtct cccgctggat cgaactgccc cgcggtggcg gcgagcccga gcagcccgct      1140
     ccggtcctga agctgaaggc ggcggccgcg gacgccaagc cggtcagccc cagccctacg      1200
     tcgagcccgg cacccgatga gacctcctcc gccaccgccg acagcacgtc ggaacaggac      1260
     gccacgtcgg ccgaggaaaa ggccaccggc gagagcgaca gcgtgtcctc cggtgtgctg      1320
     atctgggtga tcgtcgccgt tctgctggtc ctcgccggcg gtgtgtggtg gctgatccgg      1380
     cgccgggtct ccgcgtcgca gcgctga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page