(data stored in ACNUC7421 zone)

EMBL: CP002047.PE136

CP002047.PE136       Location/Qualifiers
FT   CDS_pept        132914..135370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03257"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUR6"
FT                   /protein_id="ADI03257.1"
FT                   /translation="MDRRPGGAGTDDLTFVVEYFVRPLVRVFRTALDSYGLVFADPLGP
FT                   DTAFELRADLAATGRVLVMDSLSVSGAAGLMTRRAATLRAARESDTDLGALTAWSSGNA
FT                   AATVPNTLHALAEAFSRARPDAPKDPGAAFREVLAAEMRYLRPDTARLLSADASWAAWA
FT                   HSVPEQQERALAHLLAKLQDRARECRVLPDKPLPVVLIGPLTGGGERALPGLPQLCRDV
FT                   WHAGGETVFLTEGPGCPAAGYASGLARYGVPDPTVLTPRSADGAGPAAAAAALARWDRR
FT                   AEVVACLAVLGPTARAPVGWEAFGRQFPGATLLVVGHDDRTGSGGDDRTWSGDVPMPSS
FT                   LAPQVPDRPDVVQALEMQSPAAAPANTTAAPTLPAARSLSSLRLDVLRHNPAIEQHAVR
FT                   WSGEETRRFVDHLVTAARRNADRTARAARDTLGRRLVGAPTDAERAVRLMHHILQRKQF
FT                   KHGPSSNYPPELALREMLPFVRRGEPVPMAMVFFPNKFAHSKLKAVGDLPDLAELAMLI
FT                   RLLELMEAVHQVYSPGLFFFLAADNQHYRAHSAAKLEEGMLIMSRYAGAAGLSGKVVEI
FT                   VAYDELAERHQGTAFVTAHRALRARILAEYRAALRGLDITSGPLRTLREADLRDPRGNF
FT                   ADLFRSLVFSVRTPGTPGTPGTVPATGSWWSEVYADLYNLAEDCAAPEVIAARKEVLTT
FT                   AWDDALRYVATWHADAHTGYRSKLVPGGVQVSLRPAPGRIGLNLLGGTALSSAHATGAI
FT                   DTRGVVSREFAVALRDQCFVPLYSPLLGPQQPFAMVPVTATQARGDGAGARIDPAFLRT
FT                   TRLRRR"
     atggacaggc gtccgggcgg cgctggcacg gacgatctca ccttcgtcgt ggagtatttc        60
     gtgcggcccc tggtacgggt cttccgtacc gcactggaca gctacggact ggtgttcgcc       120
     gaccctcttg ggccggacac ggccttcgag ctgcgtgcgg acctggcagc caccggccgg       180
     gtcctggtca tggacagcct gtccgtatcc ggcgccgccg gtctgatgac gcgtcgcgcg       240
     gcgaccctgc gagcggcgcg ggagtcggat accgaccttg gcgccctcac cgcctggtcg       300
     tcggggaatg cggcagccac cgtccccaac acgctgcatg ccctggcgga ggccttctcg       360
     cgggcgcgtc cggacgcgcc taaggacccg ggcgcggcgt tcagggaggt tcttgcggcg       420
     gagatgcgtt atctgcggcc ggacaccgca cgcctgctct ccgcggacgc gagctgggcc       480
     gcatgggcac acagcgtgcc ggaacagcag gagcgcgccc tcgcgcacct gctggccaag       540
     ctccaggatc gggcacggga gtgccgggtc ctcccggaca agccgctgcc tgtggttctg       600
     atcggtcctc ttacgggtgg tggcgagcgg gccctgcccg gtctgccgca gttatgccgg       660
     gatgtgtggc acgcgggcgg ggagaccgtc ttcctgaccg aggggccggg ctgcccggcc       720
     gccggctacg catcgggcct cgcacggtac ggagtgcccg atccgacggt gctgaccccg       780
     cgctcggcag acggcgccgg gcccgccgcg gccgcggcgg cgctcgcccg gtgggatcgg       840
     cgagcggaag tcgtcgcctg tctcgcggtg ctgggcccca ccgcgcgggc tccggtcggc       900
     tgggaggcgt tcgggcgcca gttcccggga gcgacgctgc tcgttgtcgg gcatgacgac       960
     cgcaccgggt ccggtggtga cgatcgcacc tggtccggtg acgtgcccat gccctcctcc      1020
     ctcgcgccac aggtaccgga tcggccggat gtggtgcagg ccctggaaat gcagtcgccg      1080
     gccgccgcac cggccaacac aactgccgct ccgacactgc cggccgcgcg gtcgctgtcg      1140
     tccctgcggc tggatgtgct gcggcacaat ccggcgatcg aacagcacgc cgtacggtgg      1200
     agtggcgagg agacccgacg gttcgtcgac cacctggtca cggccgcccg gcgcaatgcc      1260
     gaccgcaccg cccgcgccgc ccgggacacg ctggggcgtc ggctggtcgg ggcgccgacc      1320
     gacgccgagc gggccgtgcg cctgatgcat cacatcctgc aacgcaaaca gttcaagcac      1380
     gggcccagct ccaactaccc gcccgagctg gcgttgaggg aaatgctccc cttcgtccgg      1440
     cgcggcgaac cggtcccgat ggccatggtg ttcttcccca acaagttcgc ccacagcaag      1500
     ctcaaggcag tcggcgacct tcccgatctc gccgaactgg cgatgctgat ccgcctcctg      1560
     gagctcatgg aggccgttca tcaggtgtac tcccccggtc tgttcttctt cctggcggcg      1620
     gacaaccagc actatcgcgc ccactcggcc gcgaagctcg aggagggcat gctcatcatg      1680
     agcagatacg cgggggccgc gggcctgtcc ggcaaagtcg tcgagatcgt cgcctacgac      1740
     gaactcgcgg aacggcatca gggcaccgcg ttcgtgacgg cccaccgggc cctgcgcgcc      1800
     cgtattctgg ccgagtaccg cgctgccctg cgcggcctcg acatcacctc cgggccgctg      1860
     cgtacgctcc gcgaggcgga cctgcgcgac ccgcggggca atttcgccga tcttttccgg      1920
     tcgctggtct tctccgtacg gacgcccggc acgcccggca cgcccggcac cgtgcccgcc      1980
     accggatcgt ggtggagcga ggtctacgcc gacctgtaca acctggccga ggactgcgcg      2040
     gcgcccgaag tcatcgcggc gcgcaaggag gtcctgacca ccgcgtggga cgacgctctc      2100
     cggtacgtcg ccacctggca tgccgacgcg cacaccggct accgatccaa gctcgttccc      2160
     ggtggagtgc aggtgtcgct gcggcccgcg cccggcagaa tcggtctcaa cctgctgggc      2220
     ggcaccgccc tgtcgtccgc gcacgccact ggtgccatcg acacccgggg ggtcgtctcc      2280
     cgcgagttcg cggtggctct gcgggaccag tgcttcgtcc ccctgtactc accgctgctc      2340
     ggtccgcaac agccgttcgc catggtcccg gtgaccgcca cccaggcgag gggcgacggg      2400
     gccggcgccc gtatcgatcc ggcgtttctg cgcaccacgc gcctgcggcg gagatga         2457
//

If you have problems or comments...

PBIL Back to PBIL home page