(data stored in ACNUC7421 zone)

EMBL: CP002047.PE140

CP002047.PE140       Location/Qualifiers
FT   CDS_pept        complement(142265..148906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00140"
FT                   /product="amino acid adenylation domain-containing protein"
FT                   /note="COG1020 Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03261"
FT                   /db_xref="GOA:D7BUS0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS0"
FT                   /protein_id="ADI03261.1"
FT                   /translation="MDQRPLSFSQEALWFLCRLQPDSPFYNMSRGYRLCGTLERQALEK
FT                   AFADVVRRHAILRTRIVERDDRPELVVDPPLSRWTFETADVRGLPTLQRQAEVSRLNLE
FT                   LARRPFDLAHDLPVRARLMRLDESQHVLHVVFHHIVADRWSLDRVLAPELAERYAAHLA
FT                   GDAAPMPELTTQYWDFARRQREELTEERRRSQRRYWWDSLIGAPAVLEVPGDRPRPPTR
FT                   AYRGETYAFSLPDSLAKGAHELSRQGRTTMFMTMLTAFAGAVAQSSGTEDLIIGVPVMS
FT                   RGRFDHPELIGMFVNTLPLRIDLRGGPPALTVLKRVRSAVLGALGNGELPFEQIVAGLD
FT                   IDRDLSRNPLIQIVFQFEDVPPGARFTEPGVFAGPVGVSSRSIRFDIELHMWLRPDGGV
FT                   SGKAAYATDLYDRDTIAALVRRIERVLGAMVASPDQPLPGVAATCDRRPSHGSATSVPR
FT                   VRRLGDQPDAAASAPESVARPLTPAERLVLDVWQEVLDVTGIRPGDNFFHIGGSSLRAT
FT                   RVAARLRRRLDLEVPLRLLFQHRTAEKLAAALPAAPKAAGGELTGISRPAMPPLSFGQE
FT                   RLWFLDQLVPGSTAYVMGTGFRLVGDLDPVVLRRALDELVRRHEVLRTSFPLDASGRPW
FT                   QSVASATSATPIALPVVEVAQATDEGITDQDITDEDITNTVVRLARERVEEGFPLASGP
FT                   LLRATLFRFTPRLHALVLHIHHSVCDAVSLNLIAREISALYTAFVQGVPSALPEPPLQY
FT                   ADYATWQRQPAQVAEAEREIAHWRRRLAGLTPLDLPTDRPRPAMQSLTGGRYSFNLPQD
FT                   LTRAMARSGEGEGCTPYLVMLAAWAALLARYCDQDDVCVATPVDNRTRPELEQLVGFFA
FT                   DTVVMRIDLGGDPSFRELLHRVRDTFLEAHEHRNVPFERLVAELPVEQDASRNPLAQVA
FT                   LVLHDDRVPAIGLGPVRAEPFGLSNPATRFDLELHMRIEADRTRCLLTYAADLFDEQTV
FT                   ARMARHLVNLLGAAVADAERPVSRLELLAPEERHELLVSFNDTDLDLGAFTALHELVEE
FT                   QVRRSPDAPAVVFGDRVLSYSALDADADRLAAHLRDLGAGAERIVAVCLERSFGLVTAL
FT                   LATLKSGAAFMPLSPDDPPGRLAALLGDASPAVLVTSESLRRRLPVDLPVDLPVVVVDA
FT                   VRVEEPRPPAPRTAVEPRRMAYVLYTSGSTGKPNGAVNTHEGIVNRLRWMQTQFPLDAG
FT                   DAVLQKTPVTFDVCVWEFFWPLISGARLVLAEPGGHRDPDYLARVIREQRITTVHFVPS
FT                   MLHLFLARPGVEEATASLRRVLCSGEALDPGLQERCGRRIAADLYNLYGPAEAAVDVAF
FT                   WRCRRGPRPDTVPIGHPIANTRLYVVDRHLQPVPAGVPGELCIGGVGVGRGYLGRDTLT
FT                   ELRFPPDPFRPGPGRRLFRTGDRARHRPDGALEFLGRRDDQVKLRGVRMELGEIEAALT
FT                   AHPAVEAAAVAVRADTPGGPRLVAYAVPEPRRAGVPRRLAGMDRTGRAVGQHRTVLPDG
FT                   TPVFHRHGEETAFMYGEIFTARTYAPPGVRLPDRAVVFDIGANIGLFSLFAHRDCRDPL
FT                   VYAFEPVPQVCDILRLNAELHGIDAQVFDKALGDRPGTAEFTFYPGVSMLSGRYADSPL
FT                   DRQRVRTIASRDLGSAVSGRDVEDILDARLGATRMARPVITLSSVIEEQGIARIDLLKI
FT                   DVERGELDVLAGIADGHWPLIRRIVIEVDDADGRLAAVLDLLRSRGYTAAVDDGTGQAA
FT                   ADGLRVVHASREAAGPREPAGPRGTAGCDGPGTDSGREDEAGRLLGEGHGGPEERYTSP
FT                   DRLAGDLLAFLRHRLPLPMVPSSLVFLDELPLSPNGKTDRRRLPAPGDGPEQRGAVSPR
FT                   DDTERALAELAEGLLGVSPVGVTDDFFTLGGHSILAAQLMARVETAFGRRPSLAAFLRE
FT                   PTVEQLAGSLRADRSPDPASDGVVRLRAGTGDQPPLFLFAPLGGGVLCYRDLVRHLPPG
FT                   PAVYGLRAPGLDEGTSPEDDLARLAARQAAVVRRVWPTGPYRLAGWSFGGVVAFGVACE
FT                   LVREGARVEPPVLIDSYPVVEPATAGRRAAEFVATFVRERGPSAPPTPRRSAGTKDNDQ
FT                   LGWIISRMREIGVPPREIDDEEIARYWRVFDAAARAAERHRPTRFPGPLLLLRPRRPGR
FT                   PQAGAAGGWGTLADGGVEVRRVPGDHFTVLGADAAAELGRILTG"
     atggaccagc ggccactgtc gttcagccag gaagcactgt ggtttctctg ccggctccaa        60
     ccggacagtc ccttctacaa catgtcgcgc ggctaccggc tgtgcgggac gctggagcga       120
     caggcgctgg agaaagcgtt cgccgatgtg gtgcgccgtc acgccatcct gcgtacgagg       180
     atcgtcgagc gcgacgaccg gcctgagttg gtcgtcgatc cgccgctgtc ccgctggacc       240
     ttcgaaacgg ccgatgtgcg cgggctgccg acgttacagc ggcaggcgga agtgtcacgt       300
     ctcaacctcg agctggcgcg gcgcccgttc gacctcgctc atgacctccc cgtccgcgcc       360
     cggctgatgc gtctggacga gagccagcac gtgttacatg tggtgttcca tcacatcgtg       420
     gccgaccggt ggtccctgga ccgtgtcttg gcccccgaac tcgccgaacg ctacgccgcc       480
     catctcgcgg gcgacgccgc gccgatgccg gaactcacca cccagtactg ggacttcgcc       540
     cggcggcagc gtgaggaact gaccgaggag aggcgtcgga gccagcgccg ctactggtgg       600
     gattcgctga tcggcgcccc ggcggtgctg gaggtgcccg gcgaccggcc tcgccccccg       660
     acgcgggcgt accgaggcga gacgtacgcc ttctcactcc cggactccct ggcgaaggga       720
     gcccacgaac tgtcgcggca gggccgcacg acgatgttca tgaccatgtt gacggcgttc       780
     gccggggccg tggcgcagtc cagcggcacc gaagacctga tcatcggcgt accggtgatg       840
     agccggggaa ggttcgacca ccctgagctg atcggcatgt tcgtcaacac gctgccgcta       900
     cgcatcgacc tccgcggcgg cccgcccgcc ctgaccgtgc tcaagcgggt gcggtcggcg       960
     gtgctcgggg cgctcggaaa cggtgagctt ccgttcgagc agatcgtcgc ggggctggac      1020
     atcgaccgtg acctctcccg caacccgctc atccagatcg tgttccagtt tgaggacgtg      1080
     ccaccggggg cgcggttcac cgagccgggg gtcttcgcgg gaccggtcgg cgtctcgtcg      1140
     cggtcgatcc gtttcgacat cgaactgcat atgtggctgc ggcccgatgg cggtgtctcg      1200
     ggcaaggccg cctacgccac ggatctctac gaccgggaca cgatcgcggc cctggtgcgc      1260
     cggatcgaga gggttctcgg cgcgatggtc gcgtcccccg accagcccct gccgggtgtt      1320
     gcggcgactt gcgaccggcg gccgtcgcac gggtcggcca cctccgtgcc gcgggtgcgc      1380
     cgcctcggtg atcagcccga tgcggccgcg tccgcgccgg agtccgtagc gcgaccgctg      1440
     acccccgcgg agcgtctggt gctggacgtc tggcaggagg tgctcgacgt caccggcatc      1500
     cgtcccggcg acaacttctt ccatatcggc ggcagttcgc tgcgtgccac ccgggtcgcc      1560
     gcccggctgc gccgacggct ggacctggag gtgccgctgc gcctgctgtt ccagcaccgc      1620
     accgccgaga agctggcggc tgcgctgccg gccgcgccga aagcggcggg cggcgaactc      1680
     accggcatct cccggcccgc catgccacct ctctccttcg gtcaggaacg gctgtggttc      1740
     ctggatcagt tggtgccggg tagcaccgcc tatgtcatgg gcaccgggtt ccggctcgtc      1800
     ggcgacctgg atccggtggt gctccggcgc gcgctcgacg aactcgtccg ccgccacgag      1860
     gtcctgcgga cgtccttccc gctggacgcg tccgggcgcc cctggcagtc ggtcgcgtcg      1920
     gccacttcgg ccacaccaat cgcccttccg gtggtggagg tggcccaggc cacggacgag      1980
     ggcatcaccg accaagacat caccgacgag gacatcacca atacggtggt ccgcctggcc      2040
     cgggagcgtg tcgaagaagg cttcccgctg gcgtccggcc cgctgctgcg ggccacgctc      2100
     ttccgtttca ccccgcggct gcacgcgctc gtcctgcaca tacatcactc ggtgtgcgac      2160
     gcggtctccc tcaacctgat cgcccgtgaa atctccgccc tgtacaccgc ctttgtccaa      2220
     ggggtgccgt cggctctgcc cgagccgcca ctccagtacg ccgactacgc cacctggcag      2280
     cggcagccgg ctcaggttgc ggaggccgag cgggagatcg cccactggcg gcgccggctg      2340
     gcgggactga caccgctcga cctgcccacg gaccggccgc gccccgcaat gcagagcctg      2400
     accggcggaa ggtactcctt caacctgccc caggatctga cccgggcgat ggcgcggtcc      2460
     ggcgagggcg agggctgcac accgtatctc gtcatgctcg cggcctgggc cgcgctgctc      2520
     gcccgatact gcgaccagga cgacgtgtgc gtcgccacgc ccgtcgacaa ccggacccgg      2580
     ccggagctgg aacagctggt cgggttcttc gccgacaccg tcgtcatgcg gatcgacctc      2640
     ggcggcgatc cgtccttccg tgagctgctg caccgcgtgc gcgacacgtt cctggaggcg      2700
     cacgagcacc ggaacgtgcc ctttgaacgg ctggtggccg aactccccgt ggagcaggac      2760
     gccagtcgta acccactggc ccaggtggcc ctggtcctcc atgacgaccg tgtgcccgcc      2820
     atcgggctgg ggccggtgcg cgccgagccg ttcggcctgt ccaacccggc cacgcggttc      2880
     gacctcgaac tgcatatgcg tatcgaggcg gaccggaccc gctgcctgct cacctacgcg      2940
     gccgatctgt tcgacgagca gaccgtcgcc cgcatggccc ggcacctggt gaatctgctc      3000
     ggtgcggctg tggccgacgc ggagcggccg gtgtcccggc tggagctgct ggcccccgag      3060
     gagcggcacg aactgctcgt gtcgttcaac gacaccgacc tcgacctcgg cgctttcacc      3120
     gcgctccacg aactggtgga ggagcaggta cgccgctccc cggacgcgcc ggccgtcgtc      3180
     ttcggcgacc gtgtgctcag ctactccgca ctcgacgccg atgccgatcg cctcgccgcg      3240
     cacctgcggg acctgggcgc cggtgccgag cgcatcgtgg ccgtctgcct ggagcggtcc      3300
     ttcggcctcg tcacggcgct cctggcgacg ctgaagtccg gggccgcttt catgccgctg      3360
     agtccggacg acccgccggg acgcctggcc gcactcctcg gcgacgcgtc ccccgccgtc      3420
     ctggtcacct ccgagtcgct gcgtcggcga ctgcccgtcg acctgcccgt cgacctgccg      3480
     gtggtggtcg tcgacgcggt ccgggtcgag gagccgcgac caccggcgcc tcggacggcc      3540
     gtcgagccgc gccggatggc gtatgtgctg tacacctccg ggtccaccgg gaagccgaac      3600
     ggggccgtca acacccacga gggcatcgtc aaccggctgc gctggatgca gacccaattc      3660
     ccgctcgacg cgggggacgc cgtcctgcag aagacgccgg tcaccttcga cgtctgcgtg      3720
     tgggagttct tctggccgct gatctccggc gcccggctgg tgctggccga gcccggcgga      3780
     catcgcgatc cggactacct cgcccgggtc atccgggagc agcggatcac cacggtgcac      3840
     ttcgtaccgt cgatgctcca cctgtttctg gcccggcccg gggtcgagga ggccaccgcg      3900
     tccctgcgcc gggtgctgtg cagcggggag gcgctggacc ccgggttgca ggagcggtgc      3960
     gggcgcagga tcgccgccga cctgtacaac ctgtacggcc cggcggaggc cgcggtcgat      4020
     gtggccttct ggcggtgtcg gcgcggcccc cggccggaca ccgtgcccat cggccacccg      4080
     atcgccaaca cccggctcta cgtggtcgac aggcatctgc agccggtgcc ggcgggggta      4140
     ccgggcgagc tgtgcatcgg cggtgtcggt gtaggccgtg gctacctcgg gcgcgacact      4200
     ctgaccgaac tccgctttcc gcccgacccg ttccgccccg gtccgggccg acggctgttc      4260
     cggacgggtg accgggcgcg ccaccgcccc gacggggcgc tggagttcct gggccgccgc      4320
     gacgaccagg tcaagttgcg cggagtccgg atggaactcg gcgagatcga ggcggcgctc      4380
     accgcccacc cggcggtgga ggccgcggcc gtggcagtgc gtgcggacac tcccggcggc      4440
     ccgcggctgg tggcctatgc cgtccccgag ccgcggcggg cgggcgtgcc gcggcgcctg      4500
     gcgggtatgg accgcacggg ccgagccgtg gggcagcaca ggacggtgct gccggacggt      4560
     acgccggtgt tccaccggca tggcgaagag accgcgttca tgtacggcga gatcttcacg      4620
     gcccgcactt atgccccgcc cggtgtccgg ctgccggacc gtgcggtggt cttcgacatc      4680
     ggcgccaaca tcggcctgtt cagcctcttc gcgcaccgcg actgccgcga tccgctggtg      4740
     tacgccttcg aacccgtgcc ccaggtgtgc gacatcctgc gcctcaacgc cgagctccac      4800
     ggcatcgacg cgcaggtgtt cgacaaggcg ctgggtgacc ggccggggac cgcggagttc      4860
     accttctacc ccggtgtctc catgctgtcc ggccgatacg ccgactcccc gctcgaccgg      4920
     cagcgggtgc gtacgatcgc gtcgagggat ctcgggtcgg ccgtgtccgg acgggatgtg      4980
     gaggacattc tcgacgcgcg gctgggcgcg acgcggatgg cccggcccgt catcaccttg      5040
     tcgagcgtca tcgaggagca ggggatcgcc cggatcgacc tgctgaagat cgacgtcgag      5100
     cgcggcgaac tggatgtgct ggcggggatc gccgacgggc actggccact gatccggcgg      5160
     atcgtgatcg aggtggacga tgccgacggc cggctggccg ccgtgctcga cctgctgcgg      5220
     tcgcgtggct acacggcggc cgtggacgac ggcaccggcc aggcggctgc cgacgggctg      5280
     cgcgtggtcc acgcctcgcg tgaggccgcg gggccgcgtg agcccgccgg accgcgtggg      5340
     accgcagggt gtgacgggcc gggcaccgac tcgggccggg aggacgaggc gggccggctg      5400
     ctcggagaag ggcacggcgg cccagaggag aggtacacca gccccgaccg gctcgccggt      5460
     gatctcctcg cgtttctgcg tcaccgactg ccgctgccca tggtgccctc gtccctggtg      5520
     ttcctcgacg agttgccact gtcacccaac ggcaagaccg accgccggcg cctgcccgcg      5580
     ccgggcgacg ggccggaaca gcgcggcgcg gtgtctccgc gtgacgacac cgagcgcgcc      5640
     ctggcggagt tggcggaggg gctgctcggt gtgtcgccgg tgggcgtgac ggacgacttc      5700
     ttcacgctgg gcggccactc gatcctcgcc gcacagctga tggcccgcgt cgagaccgcg      5760
     ttcggccgcc gtccctccct ggcggctttc ctgcgggagc cgacggtcga gcagcttgcc      5820
     ggatcgctgc gcgcggaccg gtccccggat ccggcctccg acggtgtcgt acggctccgc      5880
     gcgggcaccg gcgaccagcc gccgctgttc ctcttcgcac cgctgggcgg cggagtcctg      5940
     tgctaccggg acctggtccg gcaccttccg ccggggcccg ccgtgtacgg gctgcgggcc      6000
     cccggcttgg acgagggcac cagccctgag gacgacctgg cgcgcctggc ggcccgtcag      6060
     gcggcggtcg tccgacgcgt gtggccgacc ggaccgtatc ggctggccgg ctggtcgttc      6120
     ggtggtgtcg tcgcgttcgg ggtcgcgtgc gagctcgtcc gggaaggggc gcgcgtcgag      6180
     ccgccggtgc tgatcgacag ttatccggtg gtcgaaccgg ccacggccgg gcgcagggcg      6240
     gccgagttcg tcgccacatt cgtccgagaa cgaggaccgt cggctccgcc gacaccgcgg      6300
     cgatccgcag gcaccaagga caacgaccag ctcggatgga tcatcagccg gatgcgggag      6360
     atcggcgtgc cgccgcggga gatcgacgac gaggagatcg cccggtactg gcgagtcttc      6420
     gacgcggcgg cacgggccgc cgagcggcac cggcccaccc gtttccccgg accgctcctt      6480
     ctgctgcggc cgcggcgccc gggacggccg caggccggtg cggcgggcgg ctggggcact      6540
     ctggccgacg gcggggtgga ggtgcgccgg gtaccgggcg accacttcac ggtcctgggc      6600
     gccgacgcgg ccgcggaact cggcaggatt ctgaccggct ga                         6642
//

If you have problems or comments...

PBIL Back to PBIL home page