(data stored in ACNUC7421 zone)

EMBL: CP002047.PE142

CP002047.PE142       Location/Qualifiers
FT   CDS_pept        150477..152234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00142"
FT                   /product="hypothetical protein"
FT                   /note="COG1357 Uncharacterized low-complexity proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03263"
FT                   /db_xref="GOA:D7BUS2"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS2"
FT                   /protein_id="ADI03263.1"
FT                   /translation="MRLVPGVDIDHRGTPFTEDLLRQLLRALSDPSTGKPQMGTAKFSG
FT                   ARFTGNAEFDKAQFSGDAEFDEAQFTGYAVFHGAQFSGNAQFHRTQFSDYAGFRMVQFS
FT                   GYAEFGGAQFHDNAEFDEAHFPGNAGFDGAQFSGHIRFGSARFSGYAGFDGAQFSGGAV
FT                   FGEAQFSGRARFRRARFSGYAGFDEARFYGETEFGGAQFASSAGFGRARFVVASELGPF
FT                   VCAGVVDLSRAVFEDPVTLEIAARKVLCKRTRWESTATVRLRYATADFEDAVLSAPVAV
FT                   TAHPTCFATGDDAVEKSLLSDGCDGVRVTSVQGVDAAHLVLIDADLTDCLFFGAFHLDQ
FT                   IHLEGHTVFAPTPTGWHRRGIRPTRWTRRRTLAEEHHCRAATTAPDDPRQWRPRPHLAP
FT                   GSTPKPQDVAALYRQLRKALEDGKNEPGAADFYYGECEMRRHDRTATPKGERRILWGYW
FT                   LLSGYGLRASRAFTWLFAAMSLTVLLLMGVGLPTHDPDPATTGTLHGNQISLSTSTPDP
FT                   AALHGTWSQRMTWARAEQATRAAVNSVIFRSSGQNLTSAGTYIEMVSRLLEPTLIALGA
FT                   LAIRGRIKR"
     gtgcggctgg tccccggagt cgacatcgac caccgcggca cccctttcac cgaagacctg        60
     cttcggcagc ttctgagggc actgagcgac cccagcacag gaaaacccca gatgggcact       120
     gccaagttca gcggggcgcg gttcaccggc aatgccgaat tcgataaggc acagttctcc       180
     ggcgacgcgg aattcgacga ggcgcagttc accggctacg ccgtattcca cggtgcacag       240
     ttctccggca acgcccaatt tcacaggacg cagttctccg actacgccgg tttccgcatg       300
     gtgcagttct ccggctacgc cgaattcggc ggggcacagt tccacgacaa cgccgaattc       360
     gatgaggcgc atttcccagg caacgccgga ttcgacgggg cgcagttctc cggccacatc       420
     cgattcggct cagcgcggtt ctccggctac gccggattcg acggggcgca gttctccggc       480
     ggcgccgtat tcggcgaggc gcagttctcc ggccgtgccc ggttccgcag ggcacggttc       540
     tccggctacg ccggattcga cgaggcacgg ttctacggcg aaaccgagtt cggcggggcg       600
     cagttcgcca gcagcgccgg gttcggcagg gcgcggttcg tggtggcttc ggagttaggg       660
     ccgttcgtgt gcgcgggagt ggtggacctg tccagggctg tgttcgagga cccggtgacg       720
     ctggagatcg ctgcgcgtaa ggtgctctgc aagcggaccc ggtgggagtc gaccgcgacg       780
     gtgcgtctgc gctacgccac agcagacttc gaggatgcgg tgctgtcggc gccggtggcg       840
     gtcaccgcac accccacctg tttcgccacc ggggacgacg ccgtggaaaa gagcttgctg       900
     tcagacggct gcgacggggt gcgggtgacc tcggtacagg gcgtggacgc cgcccatctg       960
     gtgctgatcg acgccgacct gaccgactgc ctgttcttcg gggccttcca cctcgaccag      1020
     atccatctgg aaggccacac cgtcttcgca cccacgccca ccggctggca ccgccgtgga      1080
     atccgcccga cgcggtggac acgccgacgc accctggccg aggaacacca ctgccgggca      1140
     gcgaccaccg ccccagatga cccccgccag tggcgtccgc gcccgcacct cgcccccggc      1200
     tccaccccca agccccagga cgtcgccgcc ctctaccggc aactccgcaa agccctcgaa      1260
     gacggcaaga acgaacccgg cgccgccgac ttctactacg gcgaatgcga gatgcgccgc      1320
     cacgaccgca ccgccacccc gaagggcgaa cgccgcattc tgtggggcta ctggctgctg      1380
     tccggctacg gcctgcgcgc ctcccgcgcc ttcacctggc tgttcgccgc gatgtcgctg      1440
     accgtgctgc tcctcatggg cgtcggcctg cccacccatg accccgaccc cgccaccacc      1500
     ggaaccctcc acggcaacca gatcagcctc agcaccagca cccccgaccc cgccgccctg      1560
     cacggcacat ggtcacagcg catgacctgg gcccgcgcgg agcaagccac ccgtgccgcc      1620
     gtgaactcgg tgatcttccg ctcctccgga cagaacctca cctccgccgg cacctacatc      1680
     gagatggtct cccgcctcct cgaacccacc ctcatcgccc tcggcgccct cgccatccgc      1740
     ggacgcatca aacgctga                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page