(data stored in ACNUC7421 zone)

EMBL: CP002047.PE143

CP002047.PE143       Location/Qualifiers
FT   CDS_pept        complement(152363..152773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00143"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03264"
FT                   /db_xref="GOA:D7BUS3"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS3"
FT                   /protein_id="ADI03264.1"
FT                   /translation="MPANATAHVRTARPSHDLQAAERFWVSGLGLDVLYRHTSDGTPGD
FT                   HSLLMVGWPHAAWHLELTRDPHAPVAPRPTPEDLFVIYLGEPVPESLVERLEQHGGKRV
FT                   PAHNPYWDTWGVTIQDPDGYLLVLSTRSWSNS"
     atgccggcca acgccaccgc gcatgtgcgc accgcccgcc cgtcacatga tctacaagcg        60
     gcggagaggt tctgggtctc cggcctcggc ctcgacgtcc tgtaccggca cacgtcggat       120
     ggcacccctg gtgaccactc gctcctgatg gtcggctggc cgcatgcggc ctggcacctc       180
     gaactcaccc gtgaccccca cgccccggtg gccccgcggc cgacgcctga ggacctcttc       240
     gtgatctatc tcggcgagcc ggtgccggag tctctggtcg agaggctcga acagcacggc       300
     ggcaagcgag taccggcgca caacccctac tgggacacct ggggtgtgac cattcaggac       360
     ccggatggct acttgctggt gctgtccacc cgctcttggt ccaactcgtg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page