(data stored in ACNUC7421 zone)

EMBL: CP002047.PE144

CP002047.PE144       Location/Qualifiers
FT   CDS_pept        complement(152995..153594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00144"
FT                   /product="hypothetical protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03265"
FT                   /db_xref="GOA:D7BUS4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS4"
FT                   /protein_id="ADI03265.1"
FT                   /translation="MLRTSDAESFSVRKLAAALGTDSSSLYRHFRNKTELLRAVADRIL
FT                   MAAMDGYHPEGDWKQRITALALRLREAFGRQPQLAAIWGRYASSGTGSRLVMEEVLQAL
FT                   RASGLPDEEIPARYHRIVILLAALIASETGVSTITPEEYEQGMELFRVAVLGADPERFP
FT                   ALSHFARDIRPLGADRRAAFEDILVAQLAHIEAGIP"
     ttgctgcgta cgagcgacgc cgagtcgttc agtgtgcgca agctggccgc agcgctcggg        60
     accgattcct ccagccttta ccggcacttc cgcaacaaga ccgaactgct gcgggcggtc       120
     gccgaccgga tcctcatggc cgccatggac ggctaccatc ccgagggtga ctggaagcag       180
     cgcatcaccg ccctggccct gcgactgaga gaagccttcg gccggcaacc ccagctcgcc       240
     gcgatctggg gccgctacgc gtcaagcggc accggttccc ggctggtcat ggaagaggtg       300
     ctgcaggccc tgcgggcatc gggcctgccc gacgaggaga tcccggcgcg ctaccaccgg       360
     atcgtgatcc tcctcgccgc gttgatcgcc tccgagaccg gggtcagcac catcaccccc       420
     gaagagtacg aacagggcat ggagctgttc cgcgtcgcgg tactgggcgc cgaccccgaa       480
     cgtttccccg ccctgtccca cttcgcccgc gacatccgcc ccctcggagc ggaccgccgc       540
     gccgcattcg aagacatcct cgtcgcccaa ctcgcccata tcgaggccgg gatcccctga       600
//

If you have problems or comments...

PBIL Back to PBIL home page