(data stored in ACNUC7421 zone)

EMBL: CP002047.PE146

CP002047.PE146       Location/Qualifiers
FT   CDS_pept        154830..155279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00146"
FT                   /product="hypothetical protein"
FT                   /note="COG0469 Pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03267"
FT                   /db_xref="GOA:D7BUS6"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS6"
FT                   /protein_id="ADI03267.1"
FT                   /translation="MTKTRHERLAVAAMYTGLGLTVIATIVPYLDRATTHLLADHVRAG
FT                   YPTYSQTRVDTAVTTYLVLLSAIGAFGVIAWLGTAWAVKTGNRWARPAATLMFILGTSV
FT                   GLTGLLTKDTSGETGLPPALGWAGIAPCLAGLLAVALLWRRPRPA"
     atgacgaaga cacgtcatga gcgactggcc gtcgcggcga tgtacacggg ccttggactc        60
     accgtcatcg cgacgatcgt cccgtacctc gaccgtgcca ccacccatct actggccgac       120
     cacgtccggg ccggctatcc cacgtacagc cagacacgtg tggacacggc cgtcaccaca       180
     tacctggtcc tcttgtctgc catcggagcg ttcggcgtca tcgcctggct cgggacggcc       240
     tgggcggtca agacgggcaa tcggtgggcc cgccccgccg cgaccctgat gttcatactc       300
     ggcacaagcg tcgggctgac cgggctgctc accaaggaca cctccggcga gaccggcctg       360
     ccgccggcgc tgggctgggc cggcatcgct ccctgtctgg caggactcct ggcggtcgcg       420
     ttgttgtgga gacgaccgcg accggcgtga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page