(data stored in ACNUC7421 zone)

EMBL: CP002047.PE147

CP002047.PE147       Location/Qualifiers
FT   CDS_pept        complement(155338..155745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03268"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUS7"
FT                   /protein_id="ADI03268.1"
FT                   /translation="MNSFQMGSWQATLELAEINAPHGFMRYYRSDITAAMAGSPSSWKA
FT                   TQYLMGNHTITERMFRHDPSVMLHAPLRTLLYADPDGDTKLAVDQPSLLFASYDNSRIA
FT                   DVRRELDALLAGLVTLLGGDAPPQLTSRARS"
     atgaactcct tccagatggg ctcctggcag gccacgctcg agctcgcgga gatcaacgcc        60
     ccacacgggt tcatgcgcta ctaccgcagc gacatcaccg ctgccatggc cggctcgccg       120
     tcctcctgga aggccacgca gtatctgatg ggcaaccaca ccatcactga acgcatgttc       180
     cgccacgatc cgtcggtcat gctgcacgca ccgctgcgca ccctgctcta cgcggacccc       240
     gacggcgaca ccaaactcgc cgtcgaccag cccagcctgc tgttcgccag ctacgataac       300
     tcgcggatcg ccgacgtccg ccgcgaactc gacgccctcc tcgccgggct ggtcaccctc       360
     ctcggcggcg acgcacctcc ccaactgacg tcacgagccc gaagctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page