(data stored in ACNUC7421 zone)

EMBL: CP002047.PE15

CP002047.PE15        Location/Qualifiers
FT   CDS_pept        14035..14238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03136"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSV9"
FT                   /protein_id="ADI03136.1"
FT                   /translation="MAVPASFGVRLVCPIDEFNASRQVGDDSPALLPPPTPERVSEFFD
FT                   LMKQRIATARKYGTFRHVVGGS"
     ttggcggtcc cggcctcgtt cggcgtccga ctggtctgcc cgatcgacga gttcaacgcc        60
     tcccgtcagg tcggcgacga ttccccggcc ctgctgccgc cgccgacgcc ggagcgggtg       120
     agtgagttct tcgacctcat gaagcagcgg atcgcgaccg cgaggaagta cggcacgttc       180
     cgtcatgttg tcggcggttc gtga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page