(data stored in ACNUC7421 zone)

EMBL: CP002047.PE152

CP002047.PE152       Location/Qualifiers
FT   CDS_pept        170837..171055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00152"
FT                   /product="hypothetical protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03273"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT2"
FT                   /protein_id="ADI03273.1"
FT                   /translation="MRTSSVCGISAAKRFAYVRRIGAVLDVAFEAGELSTVIAMVDTGL
FT                   GVSIVPPLGLPTSLDEGDLFAGRRAPI"
     atgcgcacca gttcggtgtg cggcatctcg gcggcgaagc gcttcgcgta cgtgcgccgt        60
     atcggggccg tactcgacgt cgccttcgag gctggtgaac tgtcgactgt catcgccatg       120
     gtggacacgg gcctgggagt gagcatcgtg ccgcccctgg gcctgcccac ctctctcgac       180
     gaaggcgact tgttcgccgg tcgaagggcg ccgatctga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page