(data stored in ACNUC7421 zone)

EMBL: CP002047.PE156

CP002047.PE156       Location/Qualifiers
FT   CDS_pept        complement(175589..176128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00156"
FT                   /product="hypothetical protein"
FT                   /note="COG2847 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03277"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT6"
FT                   /protein_id="ADI03277.1"
FT                   /translation="MGGDSVMARPADGIRVPSPGTDRTPWRPLRAAAVPLLACLLTLGT
FT                   LVAWTTTGRAGTPAVLSVRDGRVFVPQNPEATAAFFTIDNSGGSDDRLIGVTAPAGGRA
FT                   MLSRRVVTGKGMHGMEMVSAVTVPAGGTLRMTANTVDVMIKPPPRIAPGDRLTFTLHFR
FT                   ASPPVTTRALAVRPGR"
     atgggaggcg acagcgtgat ggcccgaccc gctgacggca tacgagtccc ctcgcccggc        60
     acggaccgta ccccctggcg gccgctgcgc gcggcggcgg tcccgctgct ggcctgcctg       120
     ctgaccctcg gcacgctcgt cgcgtggacc actacgggca gggcgggcac ccccgctgtg       180
     ctgagcgttc gcgacggacg cgtcttcgta ccgcagaacc ccgaggccac ggcggccttc       240
     ttcaccatcg acaacagcgg aggcagcgac gaccggctga tcggcgtcac ggcgccggcc       300
     ggagggcgcg ccatgctgag ccggcgggtc gtgaccggca aaggcatgca cggtatggaa       360
     atggtttccg ccgtcaccgt gccggcgggc gggacgctcc gtatgaccgc gaacaccgtg       420
     gacgtgatga tcaaaccgcc gccccggatc gctccgggcg accggctcac cttcacgctc       480
     cacttccgcg ccagcccacc ggtcaccacc cgggccctgg cggtacgccc cggccggtga       540
//

If you have problems or comments...

PBIL Back to PBIL home page