(data stored in ACNUC7421 zone)

EMBL: CP002047.PE158

CP002047.PE158       Location/Qualifiers
FT   CDS_pept        complement(178536..178832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03279"
FT                   /db_xref="GOA:D7BUT8"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT8"
FT                   /protein_id="ADI03279.1"
FT                   /translation="MTSPSADRTRPSPHPIGERLRPAWPVAGFVALLALLFTLAYAVGG
FT                   LVGPVAPGMRPAGGGGQGTSGPADPGDPADSGDMGGMHGMGAPGAGAGQSGSR"
     atgacttccc cctcggccga ccggacccgg ccctcacccc accccatcgg cgaacggctg        60
     cggcccgcgt ggccggtcgc gggcttcgtc gcgctgctgg ccctgctgtt cacgctggcg       120
     tacgcggtgg gcgggctcgt gggtccggtg gcccccggga tgcggcccgc gggcggtggc       180
     gggcagggaa ccagcgggcc cgccgatccc ggtgatcccg ccgattccgg tgacatgggt       240
     ggcatgcacg gcatgggcgc tcccggcgcg ggcgccgggc agagtgggag ccggtga          297
//

If you have problems or comments...

PBIL Back to PBIL home page