(data stored in ACNUC7421 zone)

EMBL: CP002047.PE159

CP002047.PE159       Location/Qualifiers
FT   CDS_pept        complement(179233..181191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03280"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUT9"
FT                   /protein_id="ADI03280.1"
FT                   /translation="MRRSSRPLAAVIAFLTLLGLLLLPGATAAGAAPAGGAGPLPSVVP
FT                   RPQAMARLGPDVTVPAEVRVVYGDEVDRPTRDLVASVLRRAGAKRLRGGSGPGLTVTVG
FT                   RLADARVAEALRAAGGRVPEELPAEGYALAASGTAVALAGADADGTYYAAQTLRQLVTG
FT                   ARTIASVSIVDHPLMPLRGVIEGFYGSPWTHAERMDQLAFYGDVKMNTYVYAPKDDPYH
FT                   REKWREPYPADKLAQLGELVRQAADHHVRFTFALSPGTSLCYSDPADFTALQAKLGAMY
FT                   DLGVRSFSVPLDDISYTRWNCAADRTAYGEPSQRTAAQAQADLLNRVQKEFLDAREGTS
FT                   PLQTVPTEYGDVTDTAYKRTLRERLDARVEVMWTGTDVVPPRITVADAARAAAVWGRKV
FT                   FVWDNYPVNDYGQAEGRLLLAPYDAREPGLHQQLSGLVLNPMNQAAASKVALFGGADFA
FT                   WNDTGYDPDRTWRAAAAYLAGDNPDAATAPALLSFFDTQHLAPTFGAEPWQSQAPELAA
FT                   RLARFRTDWDAGRQRAALEALRPTAALLATASATIRAGVADRGFVADCAPWLDALALWG
FT                   RAFERTLDALGARLDGNTQQAEQRFAEASSLAGQAGRIRTIPGETRPEGPVRVADGVLD
FT                   TFLAAAPGLGGAGAHAP"
     atgcgccgta gctcccgccc tctggccgcc gtgatcgcgt tcctcaccct cctcgggctg        60
     ctgctgctcc ccggggccac cgccgccggg gccgcaccgg cgggcggggc cggcccgttg       120
     ccgtccgtcg tgccgcgtcc gcaggcgatg gcccggctgg gcccggacgt cacggtgccc       180
     gccgaggtgc gagtggtcta cggcgacgaa gtggaccggc ccacgcgcga tctcgttgcc       240
     tccgtactgc gccgggcggg ggcaaagcgc ctgcggggcg gctccgggcc ggggctgacg       300
     gtgaccgtgg ggcggcttgc cgacgcccgg gtcgcggagg cgctgagggc cgccgggggc       360
     cgggtgcccg aggagctgcc cgcggagggg tacgcactgg ccgcgagtgg taccgcggtg       420
     gcgctcgcgg gcgcggacgc cgacgggacg tactacgcgg cgcagacgtt gcgtcagctg       480
     gtcaccggcg cccggacgat cgcctcggtg tcgatcgtgg atcatccgct gatgccgctg       540
     cgcggggtga tcgaggggtt ctacggaagc ccgtggaccc acgccgagcg tatggaccag       600
     ctggcgttct acggggacgt caagatgaac acgtatgtct acgcgcccaa ggacgacccg       660
     taccaccggg agaagtggcg tgagccgtac ccggctgaca agctcgccca gctcggcgag       720
     ctcgtccggc aggccgccga ccaccatgtg cggttcacct tcgcgctctc ccccggtacc       780
     tccctgtgct acagcgatcc cgccgacttc acggcgcttc aggccaagtt gggggcgatg       840
     tacgacctcg gggtgcgcag cttctcggtg ccgctggacg acatcagcta cacccggtgg       900
     aactgcgccg ccgaccgcac cgcctacggc gagccctcgc agcggaccgc ggcccaggcg       960
     caggccgatc tgctgaaccg ggtgcagaag gagttcctgg acgcccgtga gggcacctcg      1020
     ccgctccaga cggtgccgac cgagtacggc gatgtcaccg acaccgcgta caagcggacc      1080
     ctgcgcgagc ggctggatgc gcgggtcgag gtcatgtgga ccggcaccga cgtggtgccg      1140
     ccgcggatca ccgtggccga cgccgcgcgg gccgccgccg tctgggggcg caaggtgttc      1200
     gtctgggaca actacccggt caacgactac ggccaggccg agggccggct gctgctcgcc      1260
     ccgtacgacg cccgtgagcc cggtctgcac cagcagctct ccggtctggt cctcaacccg      1320
     atgaaccagg ccgccgccag caaggtcgcc ctgttcggcg gggcggactt cgcctggaac      1380
     gacaccgggt acgacccgga ccgcacctgg cgggccgcgg ccgcatacct ggccggggac      1440
     aatccggacg cggccaccgc gcccgcgctg ctgtccttct tcgacaccca gcacctcgcg      1500
     cccaccttcg gcgccgaacc ctggcagtcc caggcgcccg aactggccgc ccggctggcc      1560
     cggttccgta ccgactggga cgccggacgg cagcgggcgg cgctggaggc cctgcgcccc      1620
     accgcggcgc tgctggccac cgcgtcggcc accatcaggg cgggcgtggc cgaccgcggc      1680
     ttcgtggcgg attgcgcgcc gtggctggac gcgctggcgc tgtggggccg cgcgttcgaa      1740
     cgcaccctgg acgccttggg tgcccgcctc gacggcaaca cccagcaggc cgagcagcgg      1800
     ttcgccgagg cgtcgtcgct ggccgggcag gccggacgga tccgcacgat cccgggcgag      1860
     acccgccctg agggcccggt ccgcgtcgcc gacggagtgc tcgacacctt cctggcggct      1920
     gcgcccggac tcgggggagc gggagcgcac gccccgtag                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page