(data stored in ACNUC7421 zone)

EMBL: CP002047.PE162

CP002047.PE162       Location/Qualifiers
FT   CDS_pept        complement(181764..181910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00162"
FT                   /product="luciferase-like protein"
FT                   /note="COG2141 Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03283"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU2"
FT                   /protein_id="ADI03283.1"
FT                   /translation="MQFGIFSVGDVTTDPANDRTPSEHERIKAMVAIALKAEEVGPGRL
FT                   RDR"
     atgcagttcg gcatcttctc ggtcggagac gtgacgaccg atccggccaa tgaccgcact        60
     ccgtcggagc acgaacggat caaggcgatg gtcgccatcg ccctcaaggc ggaggaggtg       120
     gggcctggac gtcttcgcga caggtga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page