(data stored in ACNUC7421 zone)

EMBL: CP002047.PE164

CP002047.PE164       Location/Qualifiers
FT   CDS_pept        182314..182457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03285"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU4"
FT                   /protein_id="ADI03285.1"
FT                   /translation="MCDVGRQVECCLSDCVLQGVLRTFGLSMAMMLGHSLHDVPDMGVP
FT                   VV"
     atgtgcgatg tcggccgcca ggtcgaatgc tgcctctccg actgcgtcct ccagggcgtc        60
     ctccgcacgt tcggcttgag catggcgatg atgctcggcc attcgctcca tgatgtgccg       120
     gatatggggg tgcccgttgt ctga                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page