(data stored in ACNUC7421 zone)

EMBL: CP002047.PE166

CP002047.PE166       Location/Qualifiers
FT   CDS_pept        183795..184073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03287"
FT                   /db_xref="GOA:D7BUU6"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU6"
FT                   /protein_id="ADI03287.1"
FT                   /translation="MYDVVSVAGIAVLVVGVLAIAAIVRSGSFIPNVRWRTCAECGHRP
FT                   SEHSINKSRCLAVVGGSGDRYDSGGDWIGWWNETYCDCSGYREQKTQ"
     atgtacgacg tcgtcagtgt ggccgggatc gccgtcctgg tggtgggcgt gctggccatt        60
     gcggccattg tgcgcagcgg ctcgttcatt ccgaacgtca ggtggcggac gtgcgccgag       120
     tgtgggcaca ggccgtccga gcacagcatc aacaaatcgc ggtgcttggc ggtggtcgga       180
     ggaagcggcg accggtacga cagtggcggc gactggatcg gttggtggaa cgaaacgtac       240
     tgcgattgct ccggctaccg tgaacagaaa actcagtga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page