(data stored in ACNUC7421 zone)

EMBL: CP002047.PE167

CP002047.PE167       Location/Qualifiers
FT   CDS_pept        184294..184932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03288"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU7"
FT                   /protein_id="ADI03288.1"
FT                   /translation="MPASFSGIASNRAMGGLVHAMSGGSRLQAWRNKQLVITVYEHGIV
FT                   VGLADDPNPFHFRYDEVTSFVQDLVKRYVNQSYRGTTTTCLVSLNDGRSHRLQGQSTRT
FT                   ERNVVEDFRNLVDPKIAAAQLPGMLAAMRQGRAVAFGAYVLEPSALTTGTGRKHKRLPW
FT                   PQVEQVTLERGLVKVTERGRRGAWATASTSAVPNLTTFLNLVREAQAGV"
     gtgcccgcct ccttctcggg gatcgcgtcg aaccgcgcca tgggcgggct tgtgcacgcc        60
     atgagcggcg gttcccgact ccaggcttgg cggaacaaac agctggtgat caccgtgtac       120
     gagcacggca tcgtcgtcgg cctcgccgac gacccgaacc cattccactt ccgctacgac       180
     gaggtgacga gctttgtcca ggacctggtc aagcgatacg tcaaccaaag ctaccgcggc       240
     acaaccacca cctgtttggt cagcctcaac gatggccgca gtcaccgatt gcagggccag       300
     tccacccgga cggagcgcaa tgtcgtcgaa gatttccgca atctcgtcga cccgaagatc       360
     gccgcagccc aactccccgg aatgctcgcg gctatgcgcc aaggccgggc tgtggccttc       420
     ggcgcctatg tcttggagcc gagcgcgctc accacaggga ccggccgcaa gcacaaacgg       480
     ctgccctggc cccaggtcga acaagtgacc ttggagcgcg gcctcgtcaa ggtgaccgag       540
     cgggggcgac gcggcgcctg ggccaccgca agcacctccg ccgtcccgaa cctcaccacc       600
     ttcctgaacc tggtgcgcga agcgcaggca ggtgtgtaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page