(data stored in ACNUC7421 zone)

EMBL: CP002047.PE168

CP002047.PE168       Location/Qualifiers
FT   CDS_pept        complement(184997..185902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00168"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03289"
FT                   /db_xref="GOA:D7BUU8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUU8"
FT                   /protein_id="ADI03289.1"
FT                   /translation="MLRVVHQQGTVTAAAEALHLTPSAVSHHMRELARQLKVPLMEPQG
FT                   RGVRLTPAGHLLIDHADALLARWEEAQAELESYRVGMAGPLRIAGFNTAISGLIAPAAG
FT                   RLRHSHPDLLVQVRECDTVASMDLLVAGKVEVAVVEPTEGGPPLDDARFEQSPLLEEPY
FT                   IMLVPADHPLAQAVSVRLEDAAAEDWIVADPGTCDHAQRVRMLCAAAGFSPRIVHAATQ
FT                   WAAVWSLVGNGLGVSLVPRLAEGPAGQAVVRMPVSSENMPTRRILTCVRRGSRRHPLVD
FT                   LGIRTLEEVVRDHRTMDDWP"
     atgctccgcg tcgtgcacca gcagggcacg gtcaccgcgg ccgcagaggc cctgcacctc        60
     accccgtcag cggtctccca ccacatgcgc gagctcgcgc ggcagctcaa ggtcccgctc       120
     atggagccgc agggccgcgg cgtccggctg accccggcag ggcacctgct catcgaccac       180
     gccgacgcgc tgctggcccg gtgggaggag gcgcaggcgg agctggagtc ctatcgggtg       240
     ggcatggccg gaccactgcg catcgcgggt ttcaacaccg cgatcagcgg cctgatcgcc       300
     cccgcggccg ggcggctgcg gcacagccat cccgacctcc tggtgcaggt gcgcgagtgt       360
     gacaccgtgg cgagcatgga cctgctggtg gcgggcaagg tggaggtcgc ggtcgtggag       420
     cccaccgagg gcgggccgcc gctggatgac gcgcggttcg agcagagccc cctgctggag       480
     gagccgtaca tcatgctggt gcccgccgat cacccgcttg cgcaggcggt atcggtgcgg       540
     ttggaggacg cggcggccga ggactggatt gtcgccgacc cgggcacctg cgaccacgcc       600
     cagcgggtgc ggatgctgtg tgcggcggcc gggttctcgc cgcggatcgt gcacgccgcc       660
     acccagtggg cggcggtctg gtcgctggtc gggaacgggc tgggcgtctc gctggtcccg       720
     cggctggccg agggcccggc gggccaggcg gtggtgcgga tgccggtgtc gagcgagaac       780
     atgccgacgc ggcggattct cacctgtgtg cgccggggca gtcggcggca cccgcttgtc       840
     gaccttggga tacgtaccct ggaagaggtg gtgcgcgacc accggaccat ggacgactgg       900
     ccctga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page