(data stored in ACNUC7421 zone)

EMBL: CP002047.PE17

CP002047.PE17        Location/Qualifiers
FT   CDS_pept        complement(14850..15002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00017"
FT                   /product="hypothetical protein"
FT                   /note="COG5659 FOG: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03138"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW1"
FT                   /protein_id="ADI03138.1"
FT                   /translation="MASALPVAWVTADAAYGQEWRFRRILEDAGAGYVLAVPKSQHVTS
FT                   PAGSW"
     ttggcctcgg cgctgcccgt ggcgtgggtg accgcggacg ccgcctatgg acaggagtgg        60
     cgcttccgcc ggattctgga ggacgccggt gccggctacg tcctagcggt gcccaagtcc       120
     cagcacgtca cctcgccagc cggatcctgg tga                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page