(data stored in ACNUC7421 zone)

EMBL: CP002047.PE170

CP002047.PE170       Location/Qualifiers
FT   CDS_pept        complement(186525..187712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00170"
FT                   /product="WD-40 repeat protein"
FT                   /note="COG2319 FOG: WD40 repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03291"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV0"
FT                   /protein_id="ADI03291.1"
FT                   /translation="MLGSASSPQARQAAAIYQASAHLHRDTDPVIRRQLLALDAARHGA
FT                   AELSDRLISSPVEGEPDAEWRVEWATGPSRLGHPTRPEDVAFTVATVAIDGRLHAVVGG
FT                   PDELVRIWDLATGEPVGEPLTGHETRVPAVATTVVDGCPYAVTGDMDGAVRVWNLTTGK
FT                   PVGEPLLGHDDEVNCVATALIDGRPHVVTVSEDETTWMWDLTTGEPVGDPLIDHEAGVP
FT                   AMATTTIDGHPHLVTGAFGGGVMVWDLGTGETARELNTGDRTNVMTVATTAIDGQPHAI
FT                   TTSYLDVVDPGDDDRLSLWDLTTGRQVADLEGDTDKVQAVATALIDGRPHAVTGGQRGR
FT                   RHPELRGTVRVRDVTTFRQAGRELLFPMPVHTVTVASNGWLIVGFGNEAAAFSRR"
     atgctcggca gcgcctcgag cccgcaggcc cggcaggccg cagcgatata tcaggcctcg        60
     gctcacctcc accgtgacac cgatcccgtg atccgccgac aactgctcgc cctggacgcg       120
     gcacgtcacg gagcggctga gctttccgac cgcctcatct cgagcccggt ggagggagag       180
     cccgacgcag agtggagagt ggaatgggcc actggcccct cccgcctcgg ccacccgacg       240
     cgccccgagg acgtggcgtt cacggtggcg accgtggcga tcgacgggcg tttgcacgcg       300
     gtcgtcggcg gccccgatga gttggtgcgg atctgggatc tggccacggg cgaaccggtg       360
     ggcgagcctc tcaccggcca tgaaaccagg gtgccggcgg tggcgaccac ggtggtcgac       420
     ggatgtccgt acgcggtgac cggggacatg gacggggcgg tacgggtctg gaatctgacc       480
     acgggcaaac ccgtgggcga gcctctcctc ggccacgatg acgaggtgaa ctgtgtggcc       540
     acagccttga tcgacggacg cccgcacgtg gtgaccgtca gcgaggacga gaccacatgg       600
     atgtgggacc tgaccacggg agaaccggtg ggcgaccccc tcatcgacca cgaagccggt       660
     gtgccggcga tggcgaccac aacgatcgac gggcatccgc acctggtcac cggtgccttc       720
     ggcgggggag tgatggtctg ggacctgggc acgggggaaa cggcacgcga actgaacacc       780
     ggcgaccgga ccaatgtgat gacggtggcg accacggcga tcgacgggca gccgcacgcc       840
     atcaccacca gctacctcga cgtcgtggat cctggcgacg atgaccgttt gtccctgtgg       900
     gacctgacta cggggcggca ggtcgccgac ctggagggcg acaccgacaa ggtccaggcg       960
     gtggcaacgg cgctgatcga cggccggcct cacgcggtca ccggcggaca gaggggaagg      1020
     cgccacccgg agctgcgggg gacggtgcgc gttcgggatg tgaccacctt ccgacaggca      1080
     gggcgagagc tactgtttcc gatgcccgtc cacaccgtga cggttgcctc caacggctgg      1140
     ctcatcgtcg gattcggcaa cgaagccgcc gcgttcagcc gccgctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page