(data stored in ACNUC7421 zone)

EMBL: CP002047.PE173

CP002047.PE173       Location/Qualifiers
FT   CDS_pept        192471..193553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00173"
FT                   /product="hypothetical protein"
FT                   /note="COG2837 Predicted iron-dependent peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03294"
FT                   /db_xref="GOA:D7BUV3"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV3"
FT                   /protein_id="ADI03294.1"
FT                   /translation="MGARSREPVPQPVLSPLTAAAIFLVATIDQGGEPVTRELLSNLNG
FT                   LQRAVGFRATPDGRLSVVVGIGSQAWDRLFAGARPAELHTFRELTGPRHRAVSTPGDLL
FT                   FHIRATRLDLCFALAAEIMERLRGVVTVRDEVHGFKYFDVRDLLGFVDGTENPTGTAAS
FT                   AAVLIGDEDPQFASGSYVVVQRYVHDLQAWKALPVEAQEMVIGRRKLSDIELDDTVKPA
FT                   DSHVALTTIEDPDGTKHEILRDNMPFGTVGQGEFGTYFIGYARTPTVTERMLRRMFLGA
FT                   PPASHDRILDFSTPVTGSLFYVPSSDFLDDLPEPPGRSETADADTAAATARFPAVNGSL
FT                   GVGGLRKQQKASTADGQSAP"
     atgggcgcac gctcccgcga gccggttccc cagccggtgc tgtccccgtt gacggctgcg        60
     gcgatcttcc tggtcgcgac catcgaccag ggcggcgaac cggtgacccg ggaactgttg       120
     tcgaatctca acggactgca gcgggccgtc ggattccgcg ccacgccgga cggacggctg       180
     agcgttgtcg taggcatcgg ctcacaggcg tgggaccgcc tgttcgccgg ggcacgcccg       240
     gcggagctgc ataccttccg tgagctgacc ggaccgcggc accgtgcggt gtcgacgccc       300
     ggtgacctgc tgttccacat ccgggccacc cgcctggacc tctgcttcgc gctggccgcc       360
     gaaatcatgg agcggcttcg cggtgtcgtc acggtgcgcg acgaggtcca tggtttcaaa       420
     tacttcgacg tacgtgacct gctcggcttc gtcgacggca cggagaaccc gacgggcacc       480
     gcggcgagcg ccgccgtgct gatcggcgac gaggacccgc agttcgcctc cggcagctat       540
     gtggtcgtgc agaggtacgt acacgacctg caggcatgga aggcccttcc cgtcgaggcg       600
     caggagatgg tgatcgggcg ccggaagctg tcggacatcg aactggacga caccgtcaaa       660
     ccagccgact cacacgtggc cctcaccacg attgaagacc ctgacgggac caagcacgag       720
     atcctgcgcg acaacatgcc cttcgggacc gtcgggcagg gcgagttcgg cacgtacttc       780
     atcggatacg cccgcactcc gaccgtgacc gagcggatgc tgaggcgcat gttcctgggc       840
     gctccgccgg cgtcccacga ccggatcctg gacttctcca cgccggtcac cgggtcgctg       900
     ttctacgtgc ccagcagcga cttcctggac gatcttcccg aaccgccggg ccggagcgag       960
     acggctgacg ccgatacggc ggcggctacg gcccgatttc cggccgtgaa cggctccctg      1020
     ggagtcggcg gtctgcgaaa gcaacagaag gcgagcaccg ccgatggaca atctgcaccg      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page