(data stored in ACNUC7421 zone)

EMBL: CP002047.PE174

CP002047.PE174       Location/Qualifiers
FT   CDS_pept        193534..194376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00174"
FT                   /product="antigen cfp29"
FT                   /note="COG1659 Uncharacterized protein, linocin/CFP29
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03295"
FT                   /db_xref="GOA:D7BUV4"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV4"
FT                   /protein_id="ADI03295.1"
FT                   /translation="MDNLHRELAPISAVAWADMEQEARRTFERHVAGRRIVDVPEPCGT
FT                   ELSGVGTGHLEAAEAPADGITAHRRAFQPLVELRVPFTVDRQQVDDVERGAKDTDWQPV
FT                   QDAARDIAFAEDRTVFEGYAAAGIAGLRSSSSNQALTMPAEVRDYPTVVSKAVSALRLA
FT                   GVGGPYAMALSVEAYTAVSGTSDYGYPVIKHMARVLGGDIVWAPAIDGAFLLSARGGDF
FT                   ELRIGQDVSIGYLSHDERSIRLYFQETLTFLVYTSEAVVPVEVAAPRPIEPPEVQTRR"
     atggacaatc tgcaccgtga actggcgccc atctcggccg tcgcgtgggc cgacatggag        60
     caggaggcac gacgcacctt tgaacgccac gtggccggcc gccggatcgt cgacgttccc       120
     gagccgtgcg gcaccgaact gtccggcgtg ggcaccggcc acctcgaggc cgccgaggct       180
     ccggccgacg gtatcacggc ccatagacgc gccttccagc ccctggtgga gctgcgggtg       240
     ccgttcaccg tggatcggca gcaggtggac gatgtcgaac gcggagccaa ggacacggac       300
     tggcagccgg tgcaggacgc ggcgcgagac atcgcgttcg ccgaggaccg gactgtgttc       360
     gagggctacg ccgccgccgg aatcgcgggc ctgcgctcaa gctcgtcgaa ccaggcgctg       420
     accatgcccg ccgaggtacg cgactacccg accgtcgtca gcaaggccgt gagcgcgctg       480
     cggctggcgg gtgtcggcgg tccgtacgcc atggcgctga gcgtcgaggc gtacaccgcc       540
     gtcagcggta cgtccgacta cggctatccg gtcatcaagc acatggcccg cgtcctgggc       600
     ggcgacatcg tctgggcgcc cgcgatcgac ggggccttcc tgctgtccgc ccggggcggc       660
     gacttcgagc tgcgcatcgg ccaggacgtg tccatcggct acctgtcgca cgacgagcgc       720
     agcatccgtc tgtacttcca ggagacgctg accttcctcg tgtacacgag cgaagccgtc       780
     gtgcccgtgg aggtggcagc accaaggccc atcgaaccgc cggaggtaca gacacggagg       840
     tag                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page