(data stored in ACNUC7421 zone)

EMBL: CP002047.PE177

CP002047.PE177       Location/Qualifiers
FT   CDS_pept        complement(196145..196615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00177"
FT                   /product="putative DNA-binding protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03298"
FT                   /db_xref="GOA:D7BUV7"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUV7"
FT                   /protein_id="ADI03298.1"
FT                   /translation="MRDAADTVDKHGGPNIARYIFLDPGAQDFFVDWDTAATATAALLR
FT                   PEAGREPRDRALRELIGELSTLSPDFRASWAMHDVRIRHDGIKRLWHPDVGELELRYHS
FT                   LDLPVSNRAVHDLTLYTAEPGTTSEDRLKLLASLAASQPHSAEPISPKSPPS"
     gtgcgcgacg ccgcggacac tgtagacaag cacggcggcc ccaacatcgc ccgctacatc        60
     ttcctcgacc ccggagccca ggacttcttc gtcgactggg acaccgccgc caccgccact       120
     gccgcgctgc tgcgccccga agccggccgc gagccccgtg accgcgccct gcgggaactg       180
     atcggagagc tgtccaccct cagccccgac ttccgcgcca gctgggccat gcacgacgtc       240
     cgtatccgcc acgacggcat caagcggttg tggcatcccg acgtgggcga gctggagctg       300
     cgctatcact ccctggacct gccggtgtcc aaccgggcgg tgcacgacct gaccctctac       360
     accgccgaac cgggcaccac ctccgaagac cggctcaaac tcctcgccag cctcgcagcc       420
     tcgcaacccc attcggcaga gcccatctca ccgaagagtc ctccttcgtg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page