(data stored in ACNUC7421 zone)

EMBL: CP002047.PE18

CP002047.PE18        Location/Qualifiers
FT   CDS_pept        complement(14972..15466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00018"
FT                   /product="hypothetical protein"
FT                   /note="COG5659 FOG: Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03139"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW2"
FT                   /protein_id="ADI03139.1"
FT                   /translation="MRDYVRGLLGPVGRKNSWQLAEQAGHTTPDGLRRLLAGARWDPDQ
FT                   VRDGLQDYVAERLGCPDGVLIIDDTGFLKKGTTSAGVQRQYSGTARRTENCQIGVFAAY
FT                   ASVKGRALVDRELYLPSPGGMIWSGAGPRRSRRIGRSRPSPSSPGGWSRAHWPRRCPWR
FT                   G"
     atgcgggact atgtgcgagg actgctgggt ccggtgggca ggaagaacag ctggcagctg        60
     gctgaacagg ccggtcacac cacccctgat ggtctgcggc gtctgctggc gggagccagg       120
     tgggatcccg accaggtgcg tgatggcctg caggactacg tggccgagcg cctcggctgt       180
     cccgatgggg tgctcatcat tgacgacacc ggatttctta agaagggcac cacctccgcc       240
     ggagtgcagc gccagtactc cggcaccgcc agacgcaccg agaactgcca gatcggcgtg       300
     ttcgccgcct atgcttcggt gaagggccgg gcgctggtgg accgggagtt gtacctgcca       360
     agtcctggag ggatgatctg gagcggcgcc gggccgcgaa gatcccggcg catcgggcgt       420
     tcgcgaccaa gcccgagctc gcccgggggc tggtcgcgcg cgcattggcc tcggcgctgc       480
     ccgtggcgtg ggtga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page