(data stored in ACNUC7421 zone)

EMBL: CP002047.PE180

CP002047.PE180       Location/Qualifiers
FT   CDS_pept        complement(198883..199392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00180"
FT                   /product="putative transcriptional regulator, TetR family
FT                   protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03301"
FT                   /db_xref="GOA:D7BUW0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUW0"
FT                   /protein_id="ADI03301.1"
FT                   /translation="MDAVAARSGVHRTTVYRRWGDVGGLLADVLDAASDDDWQPPDTGS
FT                   LEGDLAALNQEIQTAMAAQPPIMAALIAASFRSEKAADAQQRLWEDRYARCEIVVSRAV
FT                   RRGDIPPRTDARRLLIAATAPLYHQLVLLRTPHDPQLPGHAARTAVLAAAAGAFAEPEP
FT                   PSADDT"
     atggacgccg tcgccgcccg ctccggcgtg caccgcacca cggtgtaccg gcgctggggg        60
     gatgtcggcg gcctgctcgc cgacgttctc gacgcggcga gcgacgacga ctggcagccg       120
     ccggacaccg ggtcactgga aggcgatctg gcggcgctga accaggagat ccagacagcc       180
     atggccgcac agccaccgat catggcggca ctgatcgccg cctcgttccg ctcggagaag       240
     gccgccgacg cccaacagcg gctctgggag gaccggtacg cccgctgcga gatcgtcgtc       300
     agccgtgccg tccggcgtgg cgacatccca ccgcgaaccg acgctcggcg actgctcatc       360
     gccgctaccg cgccgctcta ccaccaactg gtgctcctcc gcacaccaca cgacccgcaa       420
     ctgcccggcc acgcggccag aaccgccgtc ctcgccgcgg ccgcgggcgc cttcgccgag       480
     ccggagcctc cgtcagcgga cgacacctga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page