(data stored in ACNUC7421 zone)

EMBL: CP002047.PE181

CP002047.PE181       Location/Qualifiers
FT   CDS_pept        199693..201312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00181"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03302"
FT                   /db_xref="GOA:D7BUW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUW1"
FT                   /protein_id="ADI03302.1"
FT                   /translation="MPTQITALAVSKSFNGRLVLDSVTCSLTAGERTGIIGENGSGKTT
FT                   LLRLLAGRERPDQGEVVVQATGGVGYLAQNERMEPQTTVQQIIDRALSELRTVEQRMRR
FT                   LEAAMADGDESGMAEYGELMTVFELRGGYDADARVERALHGLGLGLVARDRTVGSLSGG
FT                   ERVRLRLAAVLAAAPEVLLLDEPTNHLDDAALSWLEEHLRTRRGTTVAVSHDRVFIERV
FT                   ATSLLEVDADRRRVVRYGNGYSGYLAEKAAARQRWAQAHHQWRADIDRLREAAATTARQ
FT                   VAPGRPMKDGNKMAYDRAAGRVQQSLAARVRNAEERLRRLLTDPVPPPPEPLRFTPVLR
FT                   TRRLQGAVLDAADIAVTDRLDRTSLTVKAGERLLITGPNGAGKSTLLRVLAGEVTPDNG
FT                   SVTRRARIGYLPQEPHPGTPDETVLAAFARGRAGEAAGYAERLLSLGLFDREQLTVPVG
FT                   RLSTGQLQRLALARLLSEPSDVLLLDEPTNHVSPSLVEELETALTGYDGALVIVSHDRR
FT                   LRRRWRGTHLAMQPTPTPAARV"
     atgcctacac agatcaccgc gctcgcggtc agcaagtcct tcaatggcag gctcgttctt        60
     gactcggtga cctgctcgct caccgcgggc gagcgcaccg ggatcatcgg tgagaacgga       120
     tccggcaaga ccaccttgct gcgcctgctc gccgggcgtg aacggcccga tcagggcgaa       180
     gtcgtcgtcc aggccaccgg cggcgtcggc tatctcgccc agaacgagcg gatggagcca       240
     cagaccaccg tccagcagat catcgaccgg gccctgagcg agctacgcac cgtcgagcag       300
     cgaatgcgcc ggctggaggc cgcgatggcc gacggcgacg agtcgggcat ggccgagtac       360
     ggcgaactga tgacggtctt cgaactacgc ggcggctacg acgccgacgc ccgcgtggag       420
     cgcgctctgc acggtctcgg cctggggctg gtggctcgcg accgtaccgt gggcagcctg       480
     tccggcggag aacgggtcag attgcggctg gccgccgtcc tggcagccgc gccggaggtg       540
     ctgctgctgg acgagccgac caaccatctc gacgacgccg ccctgagctg gctggaagaa       600
     cacctgcgca cccggcgggg caccacggtg gcggtctccc acgaccgggt cttcatcgaa       660
     cgtgtcgcca ccagcctgct ggaggtggac gccgaccggc gccgcgtcgt ccggtacggc       720
     aacggctaca gcggctacct cgccgagaag gccgctgccc ggcagcgctg ggcccaggca       780
     caccaccagt ggcgggccga catcgaccgg ctccgcgagg ccgccgcgac caccgcccgc       840
     caggtggccc ccggccgacc gatgaaggac ggcaacaaga tggcctacga ccgggcggcc       900
     ggccgggtgc agcagtcgct ggccgcccgg gtgcgcaacg ccgaggaacg gctgcgccgc       960
     ctcctcaccg acccggtccc gcccccgccg gagccgctgc gcttcacccc cgtactgcgg      1020
     acccgccgcc tgcagggcgc cgtactcgac gccgccgaca tcgccgtcac ggaccgactc      1080
     gaccgcacga gcctcacggt caaggcgggc gagcgcctgc tgatcacggg gccgaacgga      1140
     gcgggcaaaa gcaccctgct gcgcgtcctg gccggggaag tcacccccga caacgggagc      1200
     gtcacccgcc gcgccaggat cggctacctc cctcaagagc cgcaccccgg gacaccggac      1260
     gagaccgtgc tggccgcctt cgcccgtgga cgggcgggag aggccgccgg atacgccgaa      1320
     cggctgctgt ccctcggcct gttcgaccgc gaacagctca ccgtgccggt cggccggctg      1380
     tccaccgggc agctgcagcg tctcgccctg gcgcgactgc tcagcgagcc gtcagacgtc      1440
     ctgttgctcg acgaacccac caaccatgtg tcgccctccc tcgtcgagga gctggaaacc      1500
     gctctgaccg gctacgacgg cgccctcgtc atcgtcagcc acgatcgccg gctgcgccgg      1560
     cgctggcggg gcacccacct ggccatgcag ccgactccga cgcccgccgc cagggtctga      1620
//

If you have problems or comments...

PBIL Back to PBIL home page