(data stored in ACNUC7421 zone)

EMBL: CP002047.PE183

CP002047.PE183       Location/Qualifiers
FT   CDS_pept        202122..203420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00183"
FT                   /product="erythromycin esterase-like protein"
FT                   /note="COG2312 Erythromycin esterase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03304"
FT                   /db_xref="GOA:D7BWE8"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR016273"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWE8"
FT                   /protein_id="ADI03304.1"
FT                   /translation="MPASPHHNPFADWLRTHAVPLTHLDPEAPLDDLEPLRTIIGDARV
FT                   VAIGENSHFINEFAILRERVLRFLVERCGFTVLAFEYGFSEGFPLDAWAQGEGTDDDLS
FT                   AHLAATIPIGVEEPLRWMRRHNRTTSPPVRFAGIDLPAAGGSLLPALTPVADYLRHIDP
FT                   ETLPMVQTAMRIAESFAGGSAADAAPAWARLATAEQDTLSATLMRLLMRFRSVEPLYVS
FT                   RGDQQSHDIALRRLEGACRGDYTFRAMADLFAGKGLTADTSARDVYMAESVLWHLERFE
FT                   PGTRVVLAAHNAHIQKTSVSFNGHLTGLPMGQHLHRALGDEYVALGLTSITGDTADMRR
FT                   DENARFGFAIDTTALEPPEPGSIEAAFADAELGLSIADFHQARPEARDSAGLAQGPDRI
FT                   RIQSAYLHTPILEAFDAILNTPASTVADNLENT"
     ttgcccgcat cgccccacca caacccgttc gccgactggc ttcgcaccca tgccgtcccc        60
     ctcacccacc tcgaccccga ggcgccgctc gacgacctgg agccgctgcg caccatcatc       120
     ggcgacgccc gcgtcgtcgc gatcggcgaa aactcccact tcatcaacga gttcgcaatc       180
     ctgcgcgagc gcgtcctgcg gttcctggtc gaacgctgcg gtttcaccgt cctggccttc       240
     gaatacggat tcagcgaagg gttccccctc gacgcatggg cccagggcga ggggacggac       300
     gacgacctgt cggcccacct cgccgcaacg atccccatcg gagtcgagga gccactgcgc       360
     tggatgcgcc ggcacaaccg cacaacctca ccaccggtgc gtttcgccgg tatcgacctc       420
     ccggcggccg gtgggtccct gcttcccgcc ctgaccccgg tcgccgacta cctgcgccac       480
     atcgatcccg aaaccctgcc gatggtccag acggcaatgc ggatcgccga atcattcgcc       540
     ggtggctccg cggccgacgc cgcgcccgcg tgggcccgcc tggccaccgc cgaacaggac       600
     accctcagcg cgaccctgat gcgcctgctc atgcggttcc gctccgtcga accgctgtac       660
     gtctcccgcg gcgaccagca gagccacgac atcgccttgc gacgcctcga aggcgcctgc       720
     cgcggcgact acaccttccg cgccatggcc gacctcttcg ccggcaaggg gctgaccgcc       780
     gacacctcgg cccgggacgt ctacatggcc gagtccgtac tctggcacct ggagcgcttc       840
     gaacccggca cccgcgtcgt gctggcggct cacaacgccc atatccagaa gacatcggtg       900
     tccttcaacg gccacctcac ggggctcccg atgggacagc atctgcaccg agcgctcggc       960
     gatgagtacg tcgccctcgg cctgacgagc atcaccggag acaccgcgga catgcgccgc      1020
     gacgagaacg cacgcttcgg tttcgccatc gacaccaccg ccctggagcc gcccgagccg      1080
     ggaagcatcg aggccgcctt cgccgatgcc gaactcgggc tcagcatcgc cgacttccac      1140
     caggcccgcc cggaggcccg cgacagcgcc ggccttgccc agggccccga ccgcatccgg      1200
     atacagagcg cctacctgca cacccccatc ctcgaggcgt tcgacgccat cctcaacacg      1260
     ccggcctcca ccgtggccga caacctcgaa aacacctga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page