(data stored in ACNUC7421 zone)

EMBL: CP002047.PE184

CP002047.PE184       Location/Qualifiers
FT   CDS_pept        204810..205736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00184"
FT                   /product="hypothetical protein"
FT                   /note="COG0405 Gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03305"
FT                   /db_xref="InterPro:IPR026935"
FT                   /db_xref="InterPro:IPR032369"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWE9"
FT                   /protein_id="ADI03305.1"
FT                   /translation="MLLRHQGLDLSEPMLFGLGSGLSFIYWDSKNMGFPFLGGRVKPFD
FT                   LTTNLATGLGLELLVQETTSPRKAWENVVAPIDAGHPVGLQLDSYHLDYFGTKVHFGGH
FT                   VVAMYGYDDRDAYLVDTDQQGGTVSTSLTSLAQARAARGPMTAKHRSFTLTVPSDLPSP
FT                   QSQIIPAITACADAFLNPPIANLGHRGIEKTGKLVRTWLQRTDNPQRDLPQAALLMEKA
FT                   GTGGALFRNLYRDFLAECTQHLDSSHLRTGHGLYTEAAALWTEAAALITRAGQSADAQC
FT                   LVQAGTVLRDLSRIEREAMQALSRLGQ"
     gtgctgttgc ggcaccaggg actcgatctg tccgagccca tgctcttcgg cctcggttcg        60
     ggtctgtcct tcatctactg ggacagcaag aacatgggct tccccttcct cgggggacgg       120
     gtcaagccct tcgacctcac cacgaacctg gccaccgggc tcggactgga gctcctggtc       180
     caggagacca cctccccccg caaggcatgg gaaaacgtgg tggcccccat cgacgccggc       240
     caccccgtcg gactgcagct cgacagctac cacctggact acttcgggac gaaggtgcat       300
     ttcggcggtc atgtcgtcgc catgtacggc tacgacgacc gcgacgccta cctggtggac       360
     accgaccagc aaggcggaac ggtatccacc agcctgacca gcctcgccca ggcgagagcc       420
     gcacgcggtc cgatgaccgc caagcaccgg tccttcaccc tcaccgtccc gagcgacctg       480
     ccctcccccc agagccagat cattcccgcc atcaccgcct gcgccgacgc cttcctcaac       540
     ccgcccatcg ccaacctcgg ccaccggggc atcgaaaaga ccggcaagct ggtacgcaca       600
     tggctccagc gaaccgacaa cccacagcga gacctgccac aggccgccct cctgatggag       660
     aaggcgggca ccggcggcgc cctgttccgt aacctctacc gcgacttcct cgccgaatgc       720
     acccaacacc tcgacagcag ccatctgcgc accggccacg ggctgtacac cgaggcagcc       780
     gccctctgga cggaagccgc agcactgatc acaagagccg gccaatcagc cgatgcgcag       840
     tgcctcgtcc aggcaggcac cgtcctccgc gatctttcac gcatagagcg cgaggccatg       900
     caggcgctga gccgcttggg gcagtaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page