(data stored in ACNUC7421 zone)

EMBL: CP002047.PE186

CP002047.PE186       Location/Qualifiers
FT   CDS_pept        complement(206941..207465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00186"
FT                   /product="hypothetical protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03307"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF1"
FT                   /protein_id="ADI03307.1"
FT                   /translation="MRLNPYGEDAVNLAAALANRRPESADELADRCRAAGLTLERPVTA
FT                   DDLDRARAALNAWERVVDAAGEQERADLLNRMLAEAAAYPRLTSHSGTGWHLHYRDAEQ
FT                   PLGSVLFTLFAVGTALHLAGRGMHRLRRCEVAECDTAFADTSRTGRQRYCSQRCANRDA
FT                   VRRHRARAAVT"
     atgaggctca acccttacgg tgaggacgcg gtgaacctgg ccgcggccct ggccaaccgc        60
     cggcccgaga gcgcggatga gctggcggac cgctgccgcg ccgccgggct cacactggag       120
     cgcccggtga cagcggacga cctcgaccgt gcccgagccg cactgaacgc ctgggagagg       180
     gtcgtcgacg ccgccgggga gcaggaacgc gccgatctgc tgaaccggat gctggccgag       240
     gccgccgcct acccccggct gacctcccac tccgggaccg gctggcatct gcactaccgg       300
     gatgcggaac agccgctcgg ctccgtactg ttcacgctgt tcgcggtcgg aaccgcactg       360
     cacctcgcgg gcaggggtat gcaccggctg cggcgctgcg aggtggccga gtgcgacacg       420
     gccttcgccg acacctcgcg caccggacgg cagcggtact gctcgcagcg ctgcgccaac       480
     cgcgacgccg tccgcaggca ccgggcgcga gccgcggtta cctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page